(data stored in ACNUC1104 zone)

EMBL: CP000717.PE244

CP000717.PE244       Location/Qualifiers
FT   CDS             complement(290130..290972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10244"
FT                   /old_locus_tag="TBFG_00241"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0241c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10244"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04587"
FT                   /protein_id="ABR04587.1"
FT                   /translation="MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVA
FT                   AYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVT
FT                   DAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQK
FT                   KPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLA
FT                   NIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL"
     MTQPSGLKNL LRAAAGALPV VPRTDQLPNR TVTVEELPID PANVAAYAAV TGLRYGNQVP        60
     LTYPFALTFP SVMSLVTGFD FPFAAMGAIH TENHITQYRP IAVTDAVGVR VRAENLREHR       120
     RGLLVDLVTN VSVGNDVAWH QVTTFLHQQR TSLSGEPKPP PQKKPKLPPP AAVLRITPAK       180
     IRRYAAVGGD HNPIHTNPIA AKLFGFPTVI AHGMFTAAAV LANIEARFPD AVRYSVRFAK       240
     PVLLPATAGL YVAEGDGGWD LTLRNMAKGY PHLTATVRGL                             280
//

If you have problems or comments...

PBIL Back to PBIL home page