(data stored in ACNUC1104 zone)

EMBL: CP000717.PE251

CP000717.PE251       Location/Qualifiers
FT   CDS             complement(299180..301120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10251"
FT                   /old_locus_tag="TBFG_00248"
FT                   /product="hypothetical succinate dehydrogenase iron-sulfur
FT                   subunit (succinic dehydrogenase)"
FT                   /note="Mapped to H37Rv Rv0248c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10251"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04594"
FT                   /protein_id="ABR04594.1"
FT                   /translation="MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKA
FT                   HTVMAEGGCAAAMGNANPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETY
FT                   GALFDRTDDGRISQRNFGGHTYPRLAHVGDRTGLELIRTLQQKVVSLQQEDHAELGDYE
FT                   ARIKVFAECTITELLKDQGAIAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNS
FT                   WEYTGDGHALALRAGATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSENS
FT                   RFMFDYIPPVFKGQYAETEEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTP
FT                   HGGVYLDIASRLTPAEIKRRLPSMYHQFKELAEVDITTQAMEVGPTCHYVMGGVEVDAD
FT                   TGAATVPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPAVSA
FT                   EAIDAAAQQALSPFEGPKDGSAPENPYALHMDLQYVMNDLVGIIRNADEISRALTLLAE
FT                   LWSRYHNVLVEGHRQYNPGWNLSIDLRNMLLVSECVARAALQRTESRGGHTRDDHPGMD
FT                   PNWRRILLVCRATETMGTGGSGSGDSNCHINVTQQLQTPMRPDLLELFEISELEKYYTD
FT                   EELAEHPGRRG"
     MVEVERHSYD VVVIGAGGAG LRAVIEARER GLKVAVVCKS LFGKAHTVMA EGGCAAAMGN        60
     ANPKDNWKTH FGDTMRGGKF LNNWRMAELH AKEAPDRVWE LETYGALFDR TDDGRISQRN       120
     FGGHTYPRLA HVGDRTGLEL IRTLQQKVVS LQQEDHAELG DYEARIKVFA ECTITELLKD       180
     QGAIAGAFGY WRESGRFIVF EAPAVVLATG GIGKSFKVTS NSWEYTGDGH ALALRAGATL       240
     INMEFVQFHP TGMVWPPSVK GILVTEGVRG DGGVLKNSEN SRFMFDYIPP VFKGQYAETE       300
     EEADQWLKDN DSARRTPDLL PRDEVARAIN SEVKAGRGTP HGGVYLDIAS RLTPAEIKRR       360
     LPSMYHQFKE LAEVDITTQA MEVGPTCHYV MGGVEVDADT GAATVPGLFA AGECAGGMHG       420
     SNRLGGNSLS DLLVFGRRAG LGAADYVRAL SSRPAVSAEA IDAAAQQALS PFEGPKDGSA       480
     PENPYALHMD LQYVMNDLVG IIRNADEISR ALTLLAELWS RYHNVLVEGH RQYNPGWNLS       540
     IDLRNMLLVS ECVARAALQR TESRGGHTRD DHPGMDPNWR RILLVCRATE TMGTGGSGSG       600
     DSNCHINVTQ QLQTPMRPDL LELFEISELE KYYTDEELAE HPGRRG                      646
//

If you have problems or comments...

PBIL Back to PBIL home page