(data stored in ACNUC1104 zone)

EMBL: CP000717.PE253

CP000717.PE253       Location/Qualifiers
FT   CDS             complement(302052..302345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10253"
FT                   /old_locus_tag="TBFG_00250"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0250c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10253"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04596"
FT                   /protein_id="ABR04596.1"
FT                   /translation="MSTTAELAELHDLVGGLRRCVTALKARFGDNPATRRIVIDADRIL
FT                   TDIELLDTDVSELDLERAAVPQPSEKIAIPDTEYDREFWRDVDDEGVGGHRY"
     MSTTAELAEL HDLVGGLRRC VTALKARFGD NPATRRIVID ADRILTDIEL LDTDVSELDL        60
     ERAAVPQPSE KIAIPDTEYD REFWRDVDDE GVGGHRY                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page