(data stored in ACNUC1104 zone)

EMBL: CP000717.PE254

CP000717.PE254       Location/Qualifiers
FT   CDS             complement(302490..302969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10254"
FT                   /old_locus_tag="TBFG_00251"
FT                   /product="heat shock protein hsp (heat-stress-induced
FT                   ribosome-binding protein A)"
FT                   /note="Mapped to H37Rv Rv0251c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10254"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04597"
FT                   /protein_id="ABR04597.1"
FT                   /translation="MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAA
FT                   EIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTL
FT                   REIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK"
     MNNLALWSRP VWDVEPWDRW LRDFFGPAAT TDWYRPVAGD FTPAAEIVKD GDDAVVRLEL        60
     PGIDVDKDVN VELDPGQPVS RLVIRGEHRD EHTQDAGDKD GRTLREIRYG SFRRSFRLPA       120
     HVTSEAIAAS YDAGVLTVRV AGAYKAPAET QAQRIAITK                              159
//

If you have problems or comments...

PBIL Back to PBIL home page