(data stored in ACNUC1104 zone)

EMBL: CP000717.PE256

CP000717.PE256       Location/Qualifiers
FT   CDS             305770..306126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10256"
FT                   /old_locus_tag="TBFG_00253"
FT                   /product="nitrite reductase [NAD(P)H] small subunit nirD"
FT                   /note="Mapped to H37Rv Rv0253"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10256"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04599"
FT                   /protein_id="ABR04599.1"
FT                   /translation="MTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSV
FT                   HAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPAR
FT                   VTPEGRIQVARVAV"
     MTLLNDIQVW TTACAYDHLI PGRGVGVLLD DGSQVALFRL DDGSVHAVGN VDPFSGAAVM        60
     SRGIVGDRGG RAMVQSPILK QAFALDDGSC LDDPRVSVPV YPARVTPEGR IQVARVAV         118
//

If you have problems or comments...

PBIL Back to PBIL home page