(data stored in ACNUC1104 zone)

EMBL: CP000717.PE257

CP000717.PE257       Location/Qualifiers
FT   CDS             complement(306142..306666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10257"
FT                   /old_locus_tag="TBFG_00254"
FT                   /product="bifunctional cobalamin biosynthesis protein cobU:
FT                   cobinamide kinase + cobinamide phosphate
FT                   guanylyltransferase"
FT                   /note="Mapped to H37Rv Rv0254c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10257"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04600"
FT                   /protein_id="ABR04600.1"
FT                   /translation="MRILVTGGVRSGKSTHAEALLGDAADVVYVAPGRPAAGSDPDWDA
FT                   RVALHRARRPPTWLTVETADVATALSEARSPVLVDCLGTWLTAIMDGEALWSAATADVY
FT                   AVLEARLDGLCAALTGLPTAIVVTNEVGLGVVPSHSSGVLFRDLLGTINRRVAAVCDEV
FT                   HLVIAGRVLKL"
     MRILVTGGVR SGKSTHAEAL LGDAADVVYV APGRPAAGSD PDWDARVALH RARRPPTWLT        60
     VETADVATAL SEARSPVLVD CLGTWLTAIM DGEALWSAAT ADVYAVLEAR LDGLCAALTG       120
     LPTAIVVTNE VGLGVVPSHS SGVLFRDLLG TINRRVAAVC DEVHLVIAGR VLKL             174
//

If you have problems or comments...

PBIL Back to PBIL home page