(data stored in ACNUC1104 zone)

EMBL: CP000717.PE259

CP000717.PE259       Location/Qualifiers
FT   CDS             complement(308194..309864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10259"
FT                   /old_locus_tag="TBFG_00256"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0256c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10259"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04602"
FT                   /protein_id="ABR04602.1"
FT                   /translation="MTAPIWMASPPEVHSALLSSGPGPGPLLVSAEGWHSLSIAYAETA
FT                   DELAALLAAVQAGTWDGPTAAVYVAAHTPYLAWLVQASANSAAMATRQETAATAYGTAL
FT                   AAMPTLAELGANHALHGVLMATNFFGINTIPIALNESDYARMWIQAATTMASYQAVSTA
FT                   AVAAAPQTTPAPQIVKANAPTAASDEPNQVQEWLQWLQKIGYTDFYNNVIQPFINWLTN
FT                   LPFLQAMFSGFDPWLPSLGNPLTFLSPANIAFALGYPMDIGSYVAFLSQTFAFIGADLA
FT                   AAFASGNPATIAFTLMFTTVEAIGTIITDTIALVKTLLEQTLALLPAALPLLAAPLAPL
FT                   TLAPASAAGGFAGLSGLAGLVGIPPSAPPVIPPVAAIAPSIPTPTPTPAPAPAPTAVTA
FT                   PTPPPGPPPPPVTAPPPVTGAGIQSFGYLVGDLNSAAQARKAVGTGVRKKTPEPDSAEA
FT                   PAAAAAPEEQVQPQRRRRPKIKQLGRGYEYLDLDPETGHDPTGSPQGAGTLGFAGTTHK
FT                   ASPGQVAGLITLPNDAFGGSPRTPMMPGTWDTDSATRVE"
     MTAPIWMASP PEVHSALLSS GPGPGPLLVS AEGWHSLSIA YAETADELAA LLAAVQAGTW        60
     DGPTAAVYVA AHTPYLAWLV QASANSAAMA TRQETAATAY GTALAAMPTL AELGANHALH       120
     GVLMATNFFG INTIPIALNE SDYARMWIQA ATTMASYQAV STAAVAAAPQ TTPAPQIVKA       180
     NAPTAASDEP NQVQEWLQWL QKIGYTDFYN NVIQPFINWL TNLPFLQAMF SGFDPWLPSL       240
     GNPLTFLSPA NIAFALGYPM DIGSYVAFLS QTFAFIGADL AAAFASGNPA TIAFTLMFTT       300
     VEAIGTIITD TIALVKTLLE QTLALLPAAL PLLAAPLAPL TLAPASAAGG FAGLSGLAGL       360
     VGIPPSAPPV IPPVAAIAPS IPTPTPTPAP APAPTAVTAP TPPPGPPPPP VTAPPPVTGA       420
     GIQSFGYLVG DLNSAAQARK AVGTGVRKKT PEPDSAEAPA AAAAPEEQVQ PQRRRRPKIK       480
     QLGRGYEYLD LDPETGHDPT GSPQGAGTLG FAGTTHKASP GQVAGLITLP NDAFGGSPRT       540
     PMMPGTWDTD SATRVE                                                       556
//

If you have problems or comments...

PBIL Back to PBIL home page