(data stored in ACNUC1104 zone)

EMBL: CP000717.PE26

CP000717.PE26        Location/Qualifiers
FT   CDS             29823..31169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10026"
FT                   /old_locus_tag="TBFG_00026"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0026"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10026"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04369"
FT                   /protein_id="ABR04369.1"
FT                   /translation="MAFDAAMSTHEDLLATIRYVRDRTGDPNAWQTGLTPTEVTAVVTS
FT                   TTRSEQLDAILRKIRQRHSNLYYPAPPDREQGDAARAIADAEAALAHQNSATAQLDLQV
FT                   VSAILNAHLKTVEGGESLHELQQEIEAAVRIRSDLDTPAGARDFQRFLIGKLKDIREVV
FT                   ATASLDAASKSALMAAWTSLYDASKGDRGDADDRGPASVGSGGAPARGAGQQPELPTRA
FT                   EPDCLLDSLLLEDPGLLADDLQVPGGTSAAIPSASSTPSLPNLGGATMPGGGATPALVP
FT                   GVSAPGGLPLSGLLRGVGDEPELTDFDERGQEVRDPADYEHSNEPDERRADDREGADED
FT                   AGLGKSESPPQAPTTVTLPNGETVTAASPQLAAAIKAAASGTPIADAFQQQGIAIPLPG
FT                   TAVANPVDPARISAGDVGVFTATPLPLALAKLFWTARFNTSQPCEGQTF"
     MAFDAAMSTH EDLLATIRYV RDRTGDPNAW QTGLTPTEVT AVVTSTTRSE QLDAILRKIR        60
     QRHSNLYYPA PPDREQGDAA RAIADAEAAL AHQNSATAQL DLQVVSAILN AHLKTVEGGE       120
     SLHELQQEIE AAVRIRSDLD TPAGARDFQR FLIGKLKDIR EVVATASLDA ASKSALMAAW       180
     TSLYDASKGD RGDADDRGPA SVGSGGAPAR GAGQQPELPT RAEPDCLLDS LLLEDPGLLA       240
     DDLQVPGGTS AAIPSASSTP SLPNLGGATM PGGGATPALV PGVSAPGGLP LSGLLRGVGD       300
     EPELTDFDER GQEVRDPADY EHSNEPDERR ADDREGADED AGLGKSESPP QAPTTVTLPN       360
     GETVTAASPQ LAAAIKAAAS GTPIADAFQQ QGIAIPLPGT AVANPVDPAR ISAGDVGVFT       420
     ATPLPLALAK LFWTARFNTS QPCEGQTF                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page