(data stored in ACNUC1104 zone)

EMBL: CP000717.PE264

CP000717.PE264       Location/Qualifiers
FT   CDS             complement(311831..312976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10264"
FT                   /old_locus_tag="TBFG_00260"
FT                   /product="transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0260c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10264"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04607"
FT                   /protein_id="ABR04607.1"
FT                   /translation="MAQAHSAPLTGYRIAVTSARRAEELCALLRRQGAEVCSAPAIKMI
FT                   ALPDDDELQNNTEALIADPPDILVAHTGIGFRGWLAAAEGWGLANELLESLSSARIISR
FT                   GPKATGALRAAGLREEWSPDSESSHEVLEYLLESGVSRTRIAVQLHGAADSWDPFPEFL
FT                   GGLRFAGAQVVPIRVYRWKPAPLGGVFDHLVTGIARRQFDAVTFTSAPAAAAVLERSRE
FT                   LDIEDQLLAALRTDVHAMCVGPVTSRPLIRKGVPTSAPERMRLGALARHIAEELPLLGS
FT                   CTFKAAGHVIEIRGTSVLVDDSVKPLSPSGMAILRALVHRPGGVVSRGDLLRVLPGDGS
FT                   DTHAVDTAVLRLRTALGDKNIVATVVKRGYRLAVDSRHDDV"
     MAQAHSAPLT GYRIAVTSAR RAEELCALLR RQGAEVCSAP AIKMIALPDD DELQNNTEAL        60
     IADPPDILVA HTGIGFRGWL AAAEGWGLAN ELLESLSSAR IISRGPKATG ALRAAGLREE       120
     WSPDSESSHE VLEYLLESGV SRTRIAVQLH GAADSWDPFP EFLGGLRFAG AQVVPIRVYR       180
     WKPAPLGGVF DHLVTGIARR QFDAVTFTSA PAAAAVLERS RELDIEDQLL AALRTDVHAM       240
     CVGPVTSRPL IRKGVPTSAP ERMRLGALAR HIAEELPLLG SCTFKAAGHV IEIRGTSVLV       300
     DDSVKPLSPS GMAILRALVH RPGGVVSRGD LLRVLPGDGS DTHAVDTAVL RLRTALGDKN       360
     IVATVVKRGY RLAVDSRHDD V                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page