(data stored in ACNUC1104 zone)

EMBL: CP000717.PE265

CP000717.PE265       Location/Qualifiers
FT   CDS             complement(313076..314485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10265"
FT                   /old_locus_tag="TBFG_00261"
FT                   /product="integral membrane nitrite extrusion protein narK3
FT                   (nitrite facilitator)"
FT                   /note="Mapped to H37Rv Rv0261c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10265"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04608"
FT                   /protein_id="ABR04608.1"
FT                   /translation="MGRSHQISDWDPEDSVAWEAGNKFIARRNLIWSVAAEHVGFSVWS
FT                   LWSVMVLFMPTSVYGFSAGDKFLLGATATLVGACLRFPYTFATAKFGGRNWTIFSALVL
FT                   LIPTVGSILLLANPGLPLWPYLVCGALAGLGGGNFAASMTNINAFFPQRLKGAALALNA
FT                   GGGNLGVPMVQLVGLLVIATAGDREPYWVCAIYLVLLAVAGLGAALYMDNLTEYRIELN
FT                   TMRAVVSEPHTWVISLLYIGTFGSFIGFSFAFGQVLQINFIASGQSTAQASLHAAQIAF
FT                   LGPLLGSLSRIYGGKLADRIGGGRVTLAAFCAMLLATGILISASTFGDHLAGPMPTATM
FT                   VGYVIGFTALFILSGIGNGSVYKMIPSIFEARSHSLQISEAERRQWSRSMSGALIGLAG
FT                   AVGALGGVGVNLALRESYPTSGTATSAFWAFGVFYLVASVLTWAIYVRRGLKSAGELVP
FT                   ATTAPAGLAYV"
     MGRSHQISDW DPEDSVAWEA GNKFIARRNL IWSVAAEHVG FSVWSLWSVM VLFMPTSVYG        60
     FSAGDKFLLG ATATLVGACL RFPYTFATAK FGGRNWTIFS ALVLLIPTVG SILLLANPGL       120
     PLWPYLVCGA LAGLGGGNFA ASMTNINAFF PQRLKGAALA LNAGGGNLGV PMVQLVGLLV       180
     IATAGDREPY WVCAIYLVLL AVAGLGAALY MDNLTEYRIE LNTMRAVVSE PHTWVISLLY       240
     IGTFGSFIGF SFAFGQVLQI NFIASGQSTA QASLHAAQIA FLGPLLGSLS RIYGGKLADR       300
     IGGGRVTLAA FCAMLLATGI LISASTFGDH LAGPMPTATM VGYVIGFTAL FILSGIGNGS       360
     VYKMIPSIFE ARSHSLQISE AERRQWSRSM SGALIGLAGA VGALGGVGVN LALRESYPTS       420
     GTATSAFWAF GVFYLVASVL TWAIYVRRGL KSAGELVPAT TAPAGLAYV                   469
//

If you have problems or comments...

PBIL Back to PBIL home page