(data stored in ACNUC1104 zone)

EMBL: CP000717.PE267

CP000717.PE267       Location/Qualifiers
FT   CDS             complement(315181..316083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10267"
FT                   /old_locus_tag="TBFG_00263"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0263c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10267"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04610"
FT                   /protein_id="ABR04610.1"
FT                   /translation="MTTLEILRSGPLALVEDLGRAGLAHLGVGRSGAADRRSHTLANRL
FT                   VANPDDWATVEVTFGGFSARVRGGDVDIAVTGADTDPTVNGIMVGTNSIHHVRDGQVIS
FT                   LGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGPSPLRAGDVLPVGEHTDDYPELD
FT                   QAPVAAIEEHLVELRVVPGPRDDWLVDPDALVHTIWMASNRSDRVGMRLQGRPLQHRWP
FT                   DRQLPGEGVTRGAIQVPPNGLPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVR
FT                   LHWARPRSRLPGQGVTQAW"
     MTTLEILRSG PLALVEDLGR AGLAHLGVGR SGAADRRSHT LANRLVANPD DWATVEVTFG        60
     GFSARVRGGD VDIAVTGADT DPTVNGIMVG TNSIHHVRDG QVISLGTPRA GLRTYLAVRG       120
     GVCVEPVLGS RSYDVMSAIG PSPLRAGDVL PVGEHTDDYP ELDQAPVAAI EEHLVELRVV       180
     PGPRDDWLVD PDALVHTIWM ASNRSDRVGM RLQGRPLQHR WPDRQLPGEG VTRGAIQVPP       240
     NGLPVILGPD HPITGSYPVV GVITDEDIDK VAQIRPGQYV RLHWARPRSR LPGQGVTQAW       300
//

If you have problems or comments...

PBIL Back to PBIL home page