(data stored in ACNUC1104 zone)

EMBL: CP000717.PE273

CP000717.PE273       Location/Qualifiers
FT   CDS             complement(323655..324848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10273"
FT                   /old_locus_tag="TBFG_00269"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0269c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10273"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04616"
FT                   /protein_id="ABR04616.1"
FT                   /translation="MSRMAAPVSLDVHGRQVIVTHPGRVVFPAHNDRKGYTKFDLVRYY
FT                   LAVAEGAMRGVAGRPMILKRFVKGISAEAVFQKRAPANRPDWVDVAELHYASGRSAAEA
FT                   VIHDAAGLAWVINLGCVDLNPHPVLAGDLDHPDELRVDLDPMPGVAWQRVVEVALVVRE
FT                   VLEDYGLTAWPKTSGSRGFHVYARIAPCWSFPQVRLAAQTVAREVERRLPDAATSRWWK
FT                   EEREGVFVDFNQNAKDRTVASAYSVRATPDARVSTPLHWEEVPGCDPAVFTMATVPSRL
FT                   ADIGDPWAGMDDAVGRLDRLLMLAEELGPPQKAQSAKPLIEIARAKTRAEAMAALDIWR
FT                   DRYPGAAALLRPADVLVDGMRGPSSIWYRIRINLQHVPADQRPPQEELIADYSPWPR"
     MSRMAAPVSL DVHGRQVIVT HPGRVVFPAH NDRKGYTKFD LVRYYLAVAE GAMRGVAGRP        60
     MILKRFVKGI SAEAVFQKRA PANRPDWVDV AELHYASGRS AAEAVIHDAA GLAWVINLGC       120
     VDLNPHPVLA GDLDHPDELR VDLDPMPGVA WQRVVEVALV VREVLEDYGL TAWPKTSGSR       180
     GFHVYARIAP CWSFPQVRLA AQTVAREVER RLPDAATSRW WKEEREGVFV DFNQNAKDRT       240
     VASAYSVRAT PDARVSTPLH WEEVPGCDPA VFTMATVPSR LADIGDPWAG MDDAVGRLDR       300
     LLMLAEELGP PQKAQSAKPL IEIARAKTRA EAMAALDIWR DRYPGAAALL RPADVLVDGM       360
     RGPSSIWYRI RINLQHVPAD QRPPQEELIA DYSPWPR                                397
//

If you have problems or comments...

PBIL Back to PBIL home page