(data stored in ACNUC1104 zone)

EMBL: CP000717.PE28

CP000717.PE28        Location/Qualifiers
FT   CDS             31615..31920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10028"
FT                   /old_locus_tag="TBFG_00028"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0028"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10028"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04371"
FT                   /protein_id="ABR04371.1"
FT                   /translation="MTDANPAFDTVHPSGHILVRSCRGGYMHSVSLSEAAMETDAETLA
FT                   EAILLTADVSCLKALLEVRNEIVAAGHTPSAQVPTTDDLNVAIEKLLAHQLRRRNR"
     MTDANPAFDT VHPSGHILVR SCRGGYMHSV SLSEAAMETD AETLAEAILL TADVSCLKAL        60
     LEVRNEIVAA GHTPSAQVPT TDDLNVAIEK LLAHQLRRRN R                           101
//

If you have problems or comments...

PBIL Back to PBIL home page