(data stored in ACNUC1104 zone)

EMBL: CP000717.PE280

CP000717.PE280       Location/Qualifiers
FT   CDS             332065..332985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10280"
FT                   /old_locus_tag="TBFG_00276"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0276"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10280"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04623"
FT                   /protein_id="ABR04623.1"
FT                   /translation="MAISLVAHQPIPHVERPMADPPRLQLARRRRSAAGPGGNEDSLMG
FT                   VALLAGPANVIMELAMPGVGYGVLESRVESGRLDRHPIKRARTTFTYVAVAVAGSDDQK
FT                   AAFRRAVNKVHAQVYSTPESPVSYHAFDPELQLWVAACLYKGGVDVYRTFVGEMDDEEA
FT                   DHHYRAGMAMGTTLQVPPQMWPPDRAAFDRYWRQSLDRVHIDDVVRDYLYPIVALRIRG
FT                   IALPGPLRRLSEGIALLITTGFLPQRFRDEMRLPWDATKQRRFDALMAVLRTVNRLMPR
FT                   FVREFPFNLMLWDLDRRMRRGRPLV"
     MAISLVAHQP IPHVERPMAD PPRLQLARRR RSAAGPGGNE DSLMGVALLA GPANVIMELA        60
     MPGVGYGVLE SRVESGRLDR HPIKRARTTF TYVAVAVAGS DDQKAAFRRA VNKVHAQVYS       120
     TPESPVSYHA FDPELQLWVA ACLYKGGVDV YRTFVGEMDD EEADHHYRAG MAMGTTLQVP       180
     PQMWPPDRAA FDRYWRQSLD RVHIDDVVRD YLYPIVALRI RGIALPGPLR RLSEGIALLI       240
     TTGFLPQRFR DEMRLPWDAT KQRRFDALMA VLRTVNRLMP RFVREFPFNL MLWDLDRRMR       300
     RGRPLV                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page