(data stored in ACNUC1104 zone)

EMBL: CP000717.PE281

CP000717.PE281       Location/Qualifiers
FT   CDS             complement(333025..333453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10281"
FT                   /old_locus_tag="TBFG_00277"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0277c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10281"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04624"
FT                   /protein_id="ABR04624.1"
FT                   /translation="MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWA
FT                   SFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGD
FT                   LIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI"
     MFLIDVNVLL AAHRGDHPNH RTVRPWFDRL LAADDPFTVP NLVWASFLRL TTNRRIFEIP        60
     SPRADAFAFV EAVNAQPHHL PTSPGPRHLV LLRKLCDEAD ASGDLIPDAV LGAIAVEHHC       120
     AVVSLDRDFA RFASVRHIRP PI                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page