(data stored in ACNUC1104 zone)

EMBL: CP000717.PE283

CP000717.PE283       Location/Qualifiers
FT   CDS             complement(333754..335433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10283"
FT                   /old_locus_tag="TBFG_00278"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0278c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10283"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04626"
FT                   /protein_id="ABR04626.1"
FT                   /translation="MFFGSGGAGGAGGFGRTTGGIGGTGGNAGLLNGSGGAGGAGGAAI
FT                   TGPGGTGGAGGIPGLIGNGGNGGDGGASVTGTGGNGGAGGNGVQIGNGGNGGSGGTGAA
FT                   AGKAGLGGLGGQLIGLDGSNAPVSTSVHTLQQAALNVVNEPFQTLTGRPLIGNGANGTP
FT                   GTGAAGGAGGWLFGNGGNGGHGATNTAATATGGAGGAGGILFGTGGNGGTGGIATGAGG
FT                   IGGAGGAGGVSLLIGSGGTGGNGGNSIGVAGIGGAGGRGGDAGLLFGAAGTGGHGAAGG
FT                   VPAGVGGAGGNGGLFANGGAGGAGGFNAAGGNGGNGGLFGTGGTGGAGTNFGAGGNGGN
FT                   GGLFGAGGTGGAAGSGGSGITTGGGGHGGNAGLLSLGASGGAGGSGGASSLAGGAGGTG
FT                   GNGALLFGFGGAGGAGGHGGAALTSIQQGGAGGAGGNGGLLFGSAGAGGAGGSGANALG
FT                   AGTGGTGGDGGHAGVFGNGGDGGCRRVWRRYRRQRWCRRQRRADRQRRQRRQRRQSRGH
FT                   ARCRRHRRAAARRERTQRLAIAGRPATTRGVEGISCSPQMMP"
     MFFGSGGAGG AGGFGRTTGG IGGTGGNAGL LNGSGGAGGA GGAAITGPGG TGGAGGIPGL        60
     IGNGGNGGDG GASVTGTGGN GGAGGNGVQI GNGGNGGSGG TGAAAGKAGL GGLGGQLIGL       120
     DGSNAPVSTS VHTLQQAALN VVNEPFQTLT GRPLIGNGAN GTPGTGAAGG AGGWLFGNGG       180
     NGGHGATNTA ATATGGAGGA GGILFGTGGN GGTGGIATGA GGIGGAGGAG GVSLLIGSGG       240
     TGGNGGNSIG VAGIGGAGGR GGDAGLLFGA AGTGGHGAAG GVPAGVGGAG GNGGLFANGG       300
     AGGAGGFNAA GGNGGNGGLF GTGGTGGAGT NFGAGGNGGN GGLFGAGGTG GAAGSGGSGI       360
     TTGGGGHGGN AGLLSLGASG GAGGSGGASS LAGGAGGTGG NGALLFGFGG AGGAGGHGGA       420
     ALTSIQQGGA GGAGGNGGLL FGSAGAGGAG GSGANALGAG TGGTGGDGGH AGVFGNGGDG       480
     GCRRVWRRYR RQRWCRRQRR ADRQRRQRRQ RRQSRGHARC RRHRRAAARR ERTQRLAIAG       540
     RPATTRGVEG ISCSPQMMP                                                    559
//

If you have problems or comments...

PBIL Back to PBIL home page