(data stored in ACNUC1104 zone)

EMBL: CP000717.PE285

CP000717.PE285       Location/Qualifiers
FT   CDS             complement(336752..339472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10285"
FT                   /old_locus_tag="TBFG_00278"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0278c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10285"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04628"
FT                   /protein_id="ABR04628.1"
FT                   /translation="MRIGRCQMSFVIAAPEVIAAAATDLASLGSSISAANAAAAANTTA
FT                   LMAAGADEVSTAIAALFGAHGQAYQALSAQAQAFHAQFVQALTSGGGAYAAAEAAAVSP
FT                   LLDPINEFFLANTGRPLIGNGANGAPGTGANGGDGGWLIGNGGAGGSGAAGVNGGAGGN
FT                   GGAGGLIGNGGAGGAGGVASSGIGGSGGAGGNAMLFGAGGAGGAGGGVVALTGGAGGAG
FT                   GAGGNAGLLFGAAGVGGAGGFTNGSALGGAGGAGGAGGLFATGGVGGSGGAGSSGGAGG
FT                   AGGAGGLFGAGGTGGHGGFADSSFGGVGGAGGAGGLFGAGGEGGSGGHSLVAGGDGGAG
FT                   GNAGMLALGAAGGAGGIGGDGGTLTAGGIGGAGGAGGNAGLLFGSGGSGGAGGFGFADG
FT                   GQGGPGGNAGTVFGSGGAGGNGGVGQGFAGGIGGAGGTPGLIGNGGNGGNGGASAVTGG
FT                   NGGIGGTGVLIGNGGNGGSGGIGAGKAGVGGVSGLLLGLDGFNAPASTSPLHTLQQNVL
FT                   NVVNEPFQTLTGRPLIGNGANGTPGTGADGGAGGWLFGNGGNGGSGATGTNGGDGGDGG
FT                   AGGIFFGTGGTGGAGGVGTTGTGGDGGAGGAAFLMGSGGNGGSGGAGLTAGGDGGDGGN
FT                   AGSFFGAAGTGGAGASTKAGGTGGTGGNGGLFANGGAGGSGGLGGDAGTGGAGGNGGLF
FT                   GAGGTGGAGGSLGPGAGGAGGNGGLFGAGGTGGSGGHGTPAAVPGGAGGAGGNAGLFSL
FT                   GASGGAGGSGGSSLTDGGGIGGVGGAGGLLFGYGGAGGAGGYSNIGAGGAGGAGGNAGM
FT                   LSGSGGSGGTGGASGAAKGGVGGNGGTAGVFGNGGDGGAGGFGAGTGGNGGVGGNAVLI
FT                   GNGGNGGNGGKAGGTPGAGGTSGLLIGENGLNGLP"
     MRIGRCQMSF VIAAPEVIAA AATDLASLGS SISAANAAAA ANTTALMAAG ADEVSTAIAA        60
     LFGAHGQAYQ ALSAQAQAFH AQFVQALTSG GGAYAAAEAA AVSPLLDPIN EFFLANTGRP       120
     LIGNGANGAP GTGANGGDGG WLIGNGGAGG SGAAGVNGGA GGNGGAGGLI GNGGAGGAGG       180
     VASSGIGGSG GAGGNAMLFG AGGAGGAGGG VVALTGGAGG AGGAGGNAGL LFGAAGVGGA       240
     GGFTNGSALG GAGGAGGAGG LFATGGVGGS GGAGSSGGAG GAGGAGGLFG AGGTGGHGGF       300
     ADSSFGGVGG AGGAGGLFGA GGEGGSGGHS LVAGGDGGAG GNAGMLALGA AGGAGGIGGD       360
     GGTLTAGGIG GAGGAGGNAG LLFGSGGSGG AGGFGFADGG QGGPGGNAGT VFGSGGAGGN       420
     GGVGQGFAGG IGGAGGTPGL IGNGGNGGNG GASAVTGGNG GIGGTGVLIG NGGNGGSGGI       480
     GAGKAGVGGV SGLLLGLDGF NAPASTSPLH TLQQNVLNVV NEPFQTLTGR PLIGNGANGT       540
     PGTGADGGAG GWLFGNGGNG GSGATGTNGG DGGDGGAGGI FFGTGGTGGA GGVGTTGTGG       600
     DGGAGGAAFL MGSGGNGGSG GAGLTAGGDG GDGGNAGSFF GAAGTGGAGA STKAGGTGGT       660
     GGNGGLFANG GAGGSGGLGG DAGTGGAGGN GGLFGAGGTG GAGGSLGPGA GGAGGNGGLF       720
     GAGGTGGSGG HGTPAAVPGG AGGAGGNAGL FSLGASGGAG GSGGSSLTDG GGIGGVGGAG       780
     GLLFGYGGAG GAGGYSNIGA GGAGGAGGNA GMLSGSGGSG GTGGASGAAK GGVGGNGGTA       840
     GVFGNGGDGG AGGFGAGTGG NGGVGGNAVL IGNGGNGGNG GKAGGTPGAG GTSGLLIGEN       900
     GLNGLP                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page