(data stored in ACNUC1104 zone)

EMBL: CP000717.PE291

CP000717.PE291       Location/Qualifiers
FT   CDS             348776..352768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10291"
FT                   /old_locus_tag="TBFG_00283"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0284"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10291"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04634"
FT                   /protein_id="ABR04634.1"
FT                   /translation="MSRLIFEARRRLAPPSSHQGTIIIEAPPELPRVIPPSLLRRALPY
FT                   LIGILIVGMIVALVATGMRVISPQTLFFPFVLLLAATALYRGNDKKMRTEEVDAERADY
FT                   LRYLSVVRDNIRAQAAEQRASALWSHPDPTALASVPGSRRQWERDPHDPDFLVLRAGRH
FT                   TVPLATTLRVNDTADEIDLEPVSHSALRSLLDTQRSIGDVPTGIDLTKVSRITVLGERA
FT                   QVRAVLRAWIAQAVTWHDPTVLGVALAARDLEGRDWNWLKWLPHVDIPGRLDALGPARN
FT                   LSTDPDELIALLGPVLADRPAFTGQPTDALRHLLIVVDDPDYDLGASPLAVGRAGVTVV
FT                   HCSASAPHREQYSDPEKPILRVAHGAIERWQTGGWQPYIDAADQFSADEAAHLARRLSR
FT                   WDSNPTHAGLRSAATRGASFTTLLGIEDASRLDVPALWAPRRRDEELRVPIGVTGTGEP
FT                   LMFDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLIVIYADFKGEAG
FT                   ADSFRDFPQVVAVISNMAEKKSLADRFADTLRGEVARREMLLREAGRKVQGSAFNSVLE
FT                   YENAIAAGHSLPPIPTLFVVADEFTLMLADHPEYAELFDYVARKGRSFRIHILFASQTL
FT                   DVGKIKDIDKNTAYRIGLKVASPSVSRQIIGVEDAYHIESGKEHKGVGFLVPAPGATPI
FT                   RFRSTYVDGIYEPPQTAKAVVVQSVPEPKLFTAAAVEPDPGTVIADTDEQEPADPPRKL
FT                   IATIGEQLARYGPRAPQLWLPPLDETIPLSAALARAGVGPRQWRWPLGEIDRPFEMRRD
FT                   PLVFDARSSAGNMVIHGGPKSGKSTALQTFILSAASLHSPHEVSFYCLDYGGGQLRALQ
FT                   DLAHVGSVASALEPERIRRTFGELEQLLLSRQQREVFRDRGANGSTPDDGFGEVFLVID
FT                   NLYGFGRDNTDQFNTRNPLLARVTELVNVGLAYGIHVIITTPSWLEVPLAMRDGLGLRL
FT                   ELRLHDARDSNVRVVGALRRPADAVPHDQPGRGLTMAAEHFLFAAPELDAQTNPVAAIN
FT                   ARYPGMAAPPVRLLPTNLAPHAVGELYRGPDQLVIGQREEDLAPVILDLAANPLLMVFG
FT                   DARSGKTTLLRHIIRTVREHSTADRVAFTVLDRRLHLVDEPLFPDNEYTANIDRIIPAM
FT                   LGLANLIEARRPPAGMSAAELSRWTFAGHTHYLIIDDVDQVPDSPAMTGPYIGQRPWTP
FT                   LIGLLAQAGDLGLRVIVTGRATGSAHLLMTSPLLRRFNDLQATTLMLAGNPADSGKIRG
FT                   ERFARLPAGRAILLTDSDSPTYVQLINPLVDAAAVSGETQQKGSQS"
     MSRLIFEARR RLAPPSSHQG TIIIEAPPEL PRVIPPSLLR RALPYLIGIL IVGMIVALVA        60
     TGMRVISPQT LFFPFVLLLA ATALYRGNDK KMRTEEVDAE RADYLRYLSV VRDNIRAQAA       120
     EQRASALWSH PDPTALASVP GSRRQWERDP HDPDFLVLRA GRHTVPLATT LRVNDTADEI       180
     DLEPVSHSAL RSLLDTQRSI GDVPTGIDLT KVSRITVLGE RAQVRAVLRA WIAQAVTWHD       240
     PTVLGVALAA RDLEGRDWNW LKWLPHVDIP GRLDALGPAR NLSTDPDELI ALLGPVLADR       300
     PAFTGQPTDA LRHLLIVVDD PDYDLGASPL AVGRAGVTVV HCSASAPHRE QYSDPEKPIL       360
     RVAHGAIERW QTGGWQPYID AADQFSADEA AHLARRLSRW DSNPTHAGLR SAATRGASFT       420
     TLLGIEDASR LDVPALWAPR RRDEELRVPI GVTGTGEPLM FDLKDEAEGG MGPHGLMIGM       480
     TGSGKSQTLM SILLSLLTTH SAERLIVIYA DFKGEAGADS FRDFPQVVAV ISNMAEKKSL       540
     ADRFADTLRG EVARREMLLR EAGRKVQGSA FNSVLEYENA IAAGHSLPPI PTLFVVADEF       600
     TLMLADHPEY AELFDYVARK GRSFRIHILF ASQTLDVGKI KDIDKNTAYR IGLKVASPSV       660
     SRQIIGVEDA YHIESGKEHK GVGFLVPAPG ATPIRFRSTY VDGIYEPPQT AKAVVVQSVP       720
     EPKLFTAAAV EPDPGTVIAD TDEQEPADPP RKLIATIGEQ LARYGPRAPQ LWLPPLDETI       780
     PLSAALARAG VGPRQWRWPL GEIDRPFEMR RDPLVFDARS SAGNMVIHGG PKSGKSTALQ       840
     TFILSAASLH SPHEVSFYCL DYGGGQLRAL QDLAHVGSVA SALEPERIRR TFGELEQLLL       900
     SRQQREVFRD RGANGSTPDD GFGEVFLVID NLYGFGRDNT DQFNTRNPLL ARVTELVNVG       960
     LAYGIHVIIT TPSWLEVPLA MRDGLGLRLE LRLHDARDSN VRVVGALRRP ADAVPHDQPG      1020
     RGLTMAAEHF LFAAPELDAQ TNPVAAINAR YPGMAAPPVR LLPTNLAPHA VGELYRGPDQ      1080
     LVIGQREEDL APVILDLAAN PLLMVFGDAR SGKTTLLRHI IRTVREHSTA DRVAFTVLDR      1140
     RLHLVDEPLF PDNEYTANID RIIPAMLGLA NLIEARRPPA GMSAAELSRW TFAGHTHYLI      1200
     IDDVDQVPDS PAMTGPYIGQ RPWTPLIGLL AQAGDLGLRV IVTGRATGSA HLLMTSPLLR      1260
     RFNDLQATTL MLAGNPADSG KIRGERFARL PAGRAILLTD SDSPTYVQLI NPLVDAAAVS      1320
     GETQQKGSQS                                                             1330
//

If you have problems or comments...

PBIL Back to PBIL home page