(data stored in ACNUC1104 zone)

EMBL: CP000717.PE293

CP000717.PE293       Location/Qualifiers
FT   CDS             353076..354617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10293"
FT                   /old_locus_tag="TBFG_00285"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0286"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10293"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04636"
FT                   /protein_id="ABR04636.1"
FT                   /translation="MAAPIWMASPPEVHSALLSNGPGPGSLVAAATAWSQLSAEYASTA
FT                   AELSGLLGAVPGWAWQGPSAEWYVAAHLPYVAWLTQASADAAGAAAQHEAAAAAYTTAL
FT                   AAMPTLAELAANHVIHTVLVATNFFGINTIPITLNEADYVRMWLQAAAVMGLYQAASGA
FT                   ALASAPRTVPAPTVMNPGGGAASTVGAVNPWQWLLALLQQLWNAYTGFYGWMLQLIWQF
FT                   LQDPIGNSIKIIIAFLTNPIQALITYGPLLFALGYQIFFNLVGWPTWGMILSSPFLLPA
FT                   GLGLGLAAIAFLPIVLAPAVIPPASTPLAAAAVAAGSVWPAVSMAVTGAGTAGAATPAA
FT                   GAAPSAGAAPAPAAPATASFAYAVGGSGDWGPSLGPTVGGRGGIKAPAATVPAAAAAAA
FT                   TRGQSRARRRRRSELRDYGDEFLDMDSDSGFGPSTGDHGAQASERGAGTLGFAGTATKE
FT                   RRVRAVGLTALAGDEFGNGPRMPMVPGTWEQGSNEPEAPDGSGRGGGDGLPHDSK"
     MAAPIWMASP PEVHSALLSN GPGPGSLVAA ATAWSQLSAE YASTAAELSG LLGAVPGWAW        60
     QGPSAEWYVA AHLPYVAWLT QASADAAGAA AQHEAAAAAY TTALAAMPTL AELAANHVIH       120
     TVLVATNFFG INTIPITLNE ADYVRMWLQA AAVMGLYQAA SGAALASAPR TVPAPTVMNP       180
     GGGAASTVGA VNPWQWLLAL LQQLWNAYTG FYGWMLQLIW QFLQDPIGNS IKIIIAFLTN       240
     PIQALITYGP LLFALGYQIF FNLVGWPTWG MILSSPFLLP AGLGLGLAAI AFLPIVLAPA       300
     VIPPASTPLA AAAVAAGSVW PAVSMAVTGA GTAGAATPAA GAAPSAGAAP APAAPATASF       360
     AYAVGGSGDW GPSLGPTVGG RGGIKAPAAT VPAAAAAAAT RGQSRARRRR RSELRDYGDE       420
     FLDMDSDSGF GPSTGDHGAQ ASERGAGTLG FAGTATKERR VRAVGLTALA GDEFGNGPRM       480
     PMVPGTWEQG SNEPEAPDGS GRGGGDGLPH DSK                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page