(data stored in ACNUC1104 zone)

EMBL: CP000717.PE295

CP000717.PE295       Location/Qualifiers
FT   CDS             354989..355279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10295"
FT                   /old_locus_tag="TBFG_00287"
FT                   /product="low molecular weight protein antigen 7 esxH (10
FT                   kda antigen) (protein TB10.4)"
FT                   /note="Mapped to H37Rv Rv0288"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10295"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04638"
FT                   /protein_id="ABR04638.1"
FT                   /translation="MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQG
FT                   DTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG"
     MSQIMYNYPA MLGHAGDMAG YAGTLQSLGA EIAVEQAALQ SAWQGDTGIT YQAWQAQWNQ        60
     AMEDLVRAYH AMSSTHEANT MAMMARDTAE AAKWGG                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page