(data stored in ACNUC1104 zone)

EMBL: CP000717.PE3

CP000717.PE3         Location/Qualifiers
FT   CDS             3381..4538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10003"
FT                   /old_locus_tag="TBFG_00003"
FT                   /product="DNA replication and repair protein recF
FT                   (single-strand DNA binding protein)"
FT                   /note="Mapped to H37Rv Rv0003"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10003"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04346"
FT                   /protein_id="ABR04346.1"
FT                   /translation="MYVRHLGLRDFRSWACVDLELHPGRTVFVGPNGYGKTNLIEALWY
FT                   STTLGSHRVSADLPLIRVGTDRAVISTIVVNDGRECAVDLEIATGRVNKARLNRSSVRS
FT                   TRDVVGVLRAVLFAPEDLGLVRGDPADRRRYLDDLAIVRRPAIAAVRAEYERVLRQRTA
FT                   LLKSVPGARYRGDRGVFDTLEVWDSRLAEHGAELVAARIDLVNQLAPEVKKAYQLLAPE
FT                   SRSASIGYRASMDVTGPSEQSDTDRQLLAARLLAALAARRDAELERGVCLVGPHRDDLI
FT                   LRLGDQPAKGFASHGEAWSLAVALRLAAYQLLRVDGGEPVLLLDDVFAELDVMRRRALA
FT                   TAAESAEQVLVTAAVLEDIPAGWDARRVHIDVRADDTGSMSVVLP"
     MYVRHLGLRD FRSWACVDLE LHPGRTVFVG PNGYGKTNLI EALWYSTTLG SHRVSADLPL        60
     IRVGTDRAVI STIVVNDGRE CAVDLEIATG RVNKARLNRS SVRSTRDVVG VLRAVLFAPE       120
     DLGLVRGDPA DRRRYLDDLA IVRRPAIAAV RAEYERVLRQ RTALLKSVPG ARYRGDRGVF       180
     DTLEVWDSRL AEHGAELVAA RIDLVNQLAP EVKKAYQLLA PESRSASIGY RASMDVTGPS       240
     EQSDTDRQLL AARLLAALAA RRDAELERGV CLVGPHRDDL ILRLGDQPAK GFASHGEAWS       300
     LAVALRLAAY QLLRVDGGEP VLLLDDVFAE LDVMRRRALA TAAESAEQVL VTAAVLEDIP       360
     AGWDARRVHI DVRADDTGSM SVVLP                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page