(data stored in ACNUC1104 zone)

EMBL: CP000717.PE302

CP000717.PE302       Location/Qualifiers
FT   CDS             complement(362086..362889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10302"
FT                   /old_locus_tag="TBFG_00294"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0295c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10302"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04645"
FT                   /protein_id="ABR04645.1"
FT                   /translation="MSRAVRPYLVLATQRSGSTLLVESLRATGCAGEPQEFFQYLPSTG
FT                   MAPQPREWFAGVDDDTILQLLDPLDPGTPDTATPVAWREHVRTSGRTPNGVWGGKLMWN
FT                   QTALLQQRAAQLPDRSGDGLRAAIRDVIGNEPVFVHVHRPDVVSQAVSFWRAVQTQVWR
FT                   GHPDPKRDSQAVYHAGAIAHIIRNLRDQENGWRAWFAEEGIDPIDIAYPVLWRNLTAIV
FT                   ASVLDAIGQDPKLAPAPMLERQANQRSDEWVDRYRAEAPRLGLPT"
     MSRAVRPYLV LATQRSGSTL LVESLRATGC AGEPQEFFQY LPSTGMAPQP REWFAGVDDD        60
     TILQLLDPLD PGTPDTATPV AWREHVRTSG RTPNGVWGGK LMWNQTALLQ QRAAQLPDRS       120
     GDGLRAAIRD VIGNEPVFVH VHRPDVVSQA VSFWRAVQTQ VWRGHPDPKR DSQAVYHAGA       180
     IAHIIRNLRD QENGWRAWFA EEGIDPIDIA YPVLWRNLTA IVASVLDAIG QDPKLAPAPM       240
     LERQANQRSD EWVDRYRAEA PRLGLPT                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page