(data stored in ACNUC1104 zone)

EMBL: CP000717.PE304

CP000717.PE304       Location/Qualifiers
FT   CDS             364382..366250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10304"
FT                   /old_locus_tag="TBFG_00296"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0297"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10304"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04647"
FT                   /protein_id="ABR04647.1"
FT                   /translation="MMAVGSLIESRRRRRRVVSWRPGVTSRREVPVSFVIAQPEMIAAA
FT                   AGELASIRSAINAANAAAAAQTTGVMSAAADEVSTAVAALFSSHAQAYQAASAQAAAFH
FT                   AQVVRTLTVDAGAYVSAEAANAGPNMLAAVNAPAQALLGRPLIGNGANGAPGTGQAGGD
FT                   GGLLFGNGGNGGSGAPGQAGGAGGAAGFFGNGGNGGDGGAGANGGAGGTAGWFFGFGGN
FT                   GGAGGIGVAGINGGLGGAGGDGGNAGFFGNGGNGGMGGAGAAGVNAVNPGLATPVTPAA
FT                   NGGNGLNLVGVPGTAGGGADGANGSAIGQAGGAGGDGGNASTSGGIGIAQTGGAGGAGG
FT                   AGGDGAPGGNGGNGGSVEHTGATGSSASGGNGATGGNGGVGAPGGAGGNGGHVSGGSVN
FT                   TAGAGGKGGNGGTGGAGGPGGHGGSVLSGPVGDSGNGGAGGDGGAGVSATDIAGTGGRG
FT                   GNGGHGGLWIGNGGDGGAGGVGGVGGAGAAGAIGGHGGDGGSVNTPIGGSEAGDGGKGG
FT                   LGGDGGGRGIFGQFGAGGAGGAGGVGGAGGAGGTGGGGGNGGAIFNAGTPGAAGTGGDG
FT                   GVGGTGAAGGKGGAGGSGGVNGATGADGAKGLDGATGGKGNNGNPG"
     MMAVGSLIES RRRRRRVVSW RPGVTSRREV PVSFVIAQPE MIAAAAGELA SIRSAINAAN        60
     AAAAAQTTGV MSAAADEVST AVAALFSSHA QAYQAASAQA AAFHAQVVRT LTVDAGAYVS       120
     AEAANAGPNM LAAVNAPAQA LLGRPLIGNG ANGAPGTGQA GGDGGLLFGN GGNGGSGAPG       180
     QAGGAGGAAG FFGNGGNGGD GGAGANGGAG GTAGWFFGFG GNGGAGGIGV AGINGGLGGA       240
     GGDGGNAGFF GNGGNGGMGG AGAAGVNAVN PGLATPVTPA ANGGNGLNLV GVPGTAGGGA       300
     DGANGSAIGQ AGGAGGDGGN ASTSGGIGIA QTGGAGGAGG AGGDGAPGGN GGNGGSVEHT       360
     GATGSSASGG NGATGGNGGV GAPGGAGGNG GHVSGGSVNT AGAGGKGGNG GTGGAGGPGG       420
     HGGSVLSGPV GDSGNGGAGG DGGAGVSATD IAGTGGRGGN GGHGGLWIGN GGDGGAGGVG       480
     GVGGAGAAGA IGGHGGDGGS VNTPIGGSEA GDGGKGGLGG DGGGRGIFGQ FGAGGAGGAG       540
     GVGGAGGAGG TGGGGGNGGA IFNAGTPGAA GTGGDGGVGG TGAAGGKGGA GGSGGVNGAT       600
     GADGAKGLDG ATGGKGNNGN PG                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page