(data stored in ACNUC1104 zone)

EMBL: CP000717.PE307

CP000717.PE307       Location/Qualifiers
FT   CDS             367185..367610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10307"
FT                   /old_locus_tag="TBFG_00299"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0301"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10307"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04650"
FT                   /protein_id="ABR04650.1"
FT                   /translation="MTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVG
FT                   FSAECGEIARREFREPPLSAMPVEYLTPRIEDRALEVQTLLADRGHHRGPSIPDLLIAA
FT                   TAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA"
     MTDQRWLIDK SALVRLTDSP DMEIWSNRIE RGLVHITGVT RLEVGFSAEC GEIARREFRE        60
     PPLSAMPVEY LTPRIEDRAL EVQTLLADRG HHRGPSIPDL LIAATAELSG LTVLHVDKDF       120
     DAIAALTGQK TERLTHRPPS A                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page