(data stored in ACNUC1104 zone)

EMBL: CP000717.PE308

CP000717.PE308       Location/Qualifiers
FT   CDS             367746..368378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10308"
FT                   /old_locus_tag="TBFG_00300"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR/acrR-family"
FT                   /note="Mapped to H37Rv Rv0302"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10308"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04651"
FT                   /protein_id="ABR04651.1"
FT                   /translation="MGVPAKKKQQQGERSRESILDATERLMATKGYAATSISDIRDACG
FT                   LAPSSIYWHFGSKEGVLAAMMERGAQRFFAAIPTWDEAHGPVEQRSERQLTELVSLQSQ
FT                   HPDFLRLFYLLSMERSQDPAVAAVVRRVRNTAIARFRDSITHLLPSDIPPGKADLVVAE
FT                   LTAFAVALSDGVYFAGHLEPDTTDVERMYRRLRQALEALIPVLLEET"
     MGVPAKKKQQ QGERSRESIL DATERLMATK GYAATSISDI RDACGLAPSS IYWHFGSKEG        60
     VLAAMMERGA QRFFAAIPTW DEAHGPVEQR SERQLTELVS LQSQHPDFLR LFYLLSMERS       120
     QDPAVAAVVR RVRNTAIARF RDSITHLLPS DIPPGKADLV VAELTAFAVA LSDGVYFAGH       180
     LEPDTTDVER MYRRLRQALE ALIPVLLEET                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page