(data stored in ACNUC1104 zone)

EMBL: CP000717.PE310

CP000717.PE310       Location/Qualifiers
FT   CDS             complement(369291..378791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10310"
FT                   /old_locus_tag="TBFG_00302"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0303"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10310"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04653"
FT                   /protein_id="ABR04653.1"
FT                   /translation="MDFVVSAPEVNSLRMYLGAGSGPMLAAAAAWDGLADELAVAASWF
FT                   GSVTSGLADAAWRGPAAVAMARAVAPYLGWLISATAQAEQAAAQARVAVATFEAARAAT
FT                   VHPAIVAANRAVLVSLVSSNLLGFNAPAIAATEAAYERMWAQDVAAMVGYHAGASAAVS
FT                   ALMPFTQQLKKLAGLSERLTSAAAAAAGPPSAAGFNLGLANVGANNVGNGNVGVFNVGF
FT                   GNLGSYNLGFANLGSDNLGLANLGGHNIGFANTGSNNVGFGNTGSNNVGIGLTGNGQIG
FT                   FGSFNSGSHNIGLFNSGSGNVGLFNSGTGNFGIGNSGTGNFGLGNTGSTNTGWFNTGDV
FT                   NTGGFNPGSYNTGNFNTGNYNTGSFNAGNYNTGYFNTGDYNTGVANTGNVNTGAFIAGN
FT                   YSNGVLWRGDYQGLIGADIALEIPAIPINAQLFSMPIHQVMVMPGSVMTIPGMRLPFTS
FT                   IVPFVVYYGPVELPQSTLTLPTVTITVGGPTTTIDGNLTGMVGGVSIPLIKIPAAPGFG
FT                   NSTTSPSSGFFNAGAGTASGFGNFGGGASGFWNLASATSGLSGFGNVGALGSGVANVGN
FT                   TISGLYNTSTSNLATPAFNSGLLHHSVGTMTLNFGLANVGGNNVGGANAGIFNVGLANL
FT                   GDYNIGFGNLGGDNLGFAHAGSYNIGFANTGSNNLGFANTGDNNIGFANIGSNNIGIGL
FT                   TGSGQIGFGSLNSGSHNIGLFNSGDGNIGLFNSGSGNFGIGNAGTGNWGIGNSGAGNFG
FT                   IGNAGSTNTGLFNSGDLNTGSLNPGSYNTGSVNTGSVNTGGFNAGNYNTGYFNTGDYNT
FT                   GMANTGNINTGAFISGNHSNGLLWRGDNQGLIDLAIGVDIPEIPIVSVDVNIPIHIPIT
FT                   ASFTDIVYSGLDLPPNTAVTVIFFGPVDIDPFTVPVIRITGPTPVVMVGGPTTAINIGA
FT                   TVVVDAINIPIIHIPATPGFGNSTGGLSSGFFNSGAGSASGFGNFGGAASGFMNLVSTT
FT                   SGMSGFLNVGALGSGVANVGNTISGIYNVGTSDLSTPAVNSGLANIGTNIAGLLRDGAG
FT                   TAAINLGLANHGNLNVGFASLGGFNFGGATIGHNNVGIGNTGIFDVGLANLGSYNIGFG
FT                   NLGDDNLGFGNFGSYNIGFGNVGNDNLGFANAGGGNIGFANTGSNNVGFGNTGSNNVGI
FT                   GLTGNGQIGFGSFNSGSGNIGLFNSGSNNIGFFNSGSGNFGIANSGSFNTGIGNTGNTN
FT                   TGLFNSGDVNTGAFNPGSFNTGSFNTGSFNTGGFNPGNTNTGYLNIGNYNTGIANTGDV
FT                   DTGAFITGNYSNGLFLSGDYQGLVGLNLVIDMPLPISLGVNIPIDIPITASAGNITLMG
FT                   VTIPPTGDIVLSSIAGQRAHFGPITIPNITVVGPTTTVAIGGPNTAITITGGGAIRIPL
FT                   ISIPAAPGFGNSTTNPSSGFFNTGAGGASGFGNFGGANSGFWNLASATSGASGLLNVGA
FT                   LGSGLANVGTTVSGFYNTSTSDLATPAFNSGLANISTSIAGLLRDSTGTMVLNLGLANH
FT                   GTLNVGIANLGDYNIGFANLGSANFGSANIGGNNIGGANTGIFDIGLANLGSYNIGFGN
FT                   FGDDNLGFANTGSNNIGFANTGSNNIGIGLTGDGQIGFGSLNSGSGNIGLFNSGSGNIG
FT                   FFNSGNGNVGIGNTGTANFGLGNTGSTNTGFFNSGDVNTGIGNTGSFNTGSFNPGDSNT
FT                   GDFNPGSYNTGLGNTGDVDTGAFISGSYSNGFLWSGNYQGLIGLHAALAIPEIALTFGV
FT                   DIPIHIPINIDAGVVTLQGFSIVAAENNIDFTPIIIPTINITLPTAAITVGGPTTSIGI
FT                   TASAGIGSITIPIIDIPATSGFGNSTTSPSSGFFNSGAGSASGFLNVVAGASGISGYLN
FT                   VGALGSGVTNVGHTVSGFYNASALDLVTPAFASGLMRDGMGTMTLNLGLANLGSNNAGF
FT                   GNTGIFDVGVANLGNYNIGFGNFGDDNLGFANLGSYNIGVANTGSNNIGFANTGSNNIG
FT                   IGLTGTGQIGIGALNSGSGNIGLFNSGDGNIGFFNSGTGNFGIGNTGTGNFGIGNSGST
FT                   STGLFNSGDGNTGGFNPGNFNTGNFNTGSFNTGGFNAGNTNTGHFNTGNYNTGIANTGD
FT                   VSTGAFISGNYSNGILWRGDYQGLIGYSYALTIPEIPAHLDVNIPIDIPITGSFTDLVV
FT                   DNFTIPIIGFESFAFSFHIHTEPDIGPIIVPSFVLSVPTFAIAVGGPTTAINISATAGL
FT                   GPITIPIIDIPAAPGIGNSTTSPSSGFFNTGAGTASGFGNVGGNTSGLWNLASAASGVS
FT                   GLLNVGALGSGVANVGNTISGIYNTSPLDLGTPAFGSGLANIAGLLQGGAGTTILDLAG
FT                   LGNLNVGLANLGGSNFGIGNTGIFNVGFANVGNHNIGLANLGNYSVGFANSGNYHIGIA
FT                   NTGSANIGFANTGSGNIGIGLTGTGQIGFGSFNSGSHNIGLFNSGDGNVGFFNSGTGNV
FT                   GIGNTGTANFGIANSGSFNTGLGNTGSTNTGLFNPGNVNTGVGNTGSINTGSINTGSFN
FT                   TGSTNTGSFNLGDHNTGSFNSGDYNTGYFNAGDYNTGVANTGNVNTGAFISGNYSNGFF
FT                   WRGDYQGLIGLSTTITIPEIPYRYDLSVPIDIPITGTVVATTPNSFTIPGFQIRVLLGP
FT                   AAVLVNEMIGPITIDVNQVIAIDSPIQQTISMVGTGGFGPIPIGISIGGTPGFGNSTTG
FT                   PSSGFFHTGAGHVSGFGNFGAGNMSGSGNFGAGNSGFFNAGGLGNSGLLNFGALQSGLA
FT                   NLGNTISGVYNTSTLDLATPAFGSGIANIGANLAGLFLDNTGNLTLNFGVANQGGLNAG
FT                   IGNLGSVNIGFVNTGDSNLGIGNLGDLNFGGVNIGGNNIGIANTGIFDIGLANLGSYNI
FT                   GLANLGDDNLGFGNAGSYNIGFANFGSDNLGFANTGSYNIGFANTGNNNIGVGLTGNGQ
FT                   IGIGSLNSGSNNIGLFNSGSGNIGFFNSGTGNVGIFNTGTGNFGLANSGGFNTGIGNAG
FT                   STNTGVFNPGDLNTGSFNPGSFNTGGFNPGSGNTGYLNTGDYNTGVANTGDVDTGAFIT
FT                   GSYSNGFLVSGDYQGLIGLPLLGIPVTPGYFNLTGGPSSGFFNSGAGSVSGFVNSGAGL
FT                   SGYLNTGALGSGVANVGNTISGWLNASALDLATPGFLSGIGNFGTNLAGFFRG"
     MDFVVSAPEV NSLRMYLGAG SGPMLAAAAA WDGLADELAV AASWFGSVTS GLADAAWRGP        60
     AAVAMARAVA PYLGWLISAT AQAEQAAAQA RVAVATFEAA RAATVHPAIV AANRAVLVSL       120
     VSSNLLGFNA PAIAATEAAY ERMWAQDVAA MVGYHAGASA AVSALMPFTQ QLKKLAGLSE       180
     RLTSAAAAAA GPPSAAGFNL GLANVGANNV GNGNVGVFNV GFGNLGSYNL GFANLGSDNL       240
     GLANLGGHNI GFANTGSNNV GFGNTGSNNV GIGLTGNGQI GFGSFNSGSH NIGLFNSGSG       300
     NVGLFNSGTG NFGIGNSGTG NFGLGNTGST NTGWFNTGDV NTGGFNPGSY NTGNFNTGNY       360
     NTGSFNAGNY NTGYFNTGDY NTGVANTGNV NTGAFIAGNY SNGVLWRGDY QGLIGADIAL       420
     EIPAIPINAQ LFSMPIHQVM VMPGSVMTIP GMRLPFTSIV PFVVYYGPVE LPQSTLTLPT       480
     VTITVGGPTT TIDGNLTGMV GGVSIPLIKI PAAPGFGNST TSPSSGFFNA GAGTASGFGN       540
     FGGGASGFWN LASATSGLSG FGNVGALGSG VANVGNTISG LYNTSTSNLA TPAFNSGLLH       600
     HSVGTMTLNF GLANVGGNNV GGANAGIFNV GLANLGDYNI GFGNLGGDNL GFAHAGSYNI       660
     GFANTGSNNL GFANTGDNNI GFANIGSNNI GIGLTGSGQI GFGSLNSGSH NIGLFNSGDG       720
     NIGLFNSGSG NFGIGNAGTG NWGIGNSGAG NFGIGNAGST NTGLFNSGDL NTGSLNPGSY       780
     NTGSVNTGSV NTGGFNAGNY NTGYFNTGDY NTGMANTGNI NTGAFISGNH SNGLLWRGDN       840
     QGLIDLAIGV DIPEIPIVSV DVNIPIHIPI TASFTDIVYS GLDLPPNTAV TVIFFGPVDI       900
     DPFTVPVIRI TGPTPVVMVG GPTTAINIGA TVVVDAINIP IIHIPATPGF GNSTGGLSSG       960
     FFNSGAGSAS GFGNFGGAAS GFMNLVSTTS GMSGFLNVGA LGSGVANVGN TISGIYNVGT      1020
     SDLSTPAVNS GLANIGTNIA GLLRDGAGTA AINLGLANHG NLNVGFASLG GFNFGGATIG      1080
     HNNVGIGNTG IFDVGLANLG SYNIGFGNLG DDNLGFGNFG SYNIGFGNVG NDNLGFANAG      1140
     GGNIGFANTG SNNVGFGNTG SNNVGIGLTG NGQIGFGSFN SGSGNIGLFN SGSNNIGFFN      1200
     SGSGNFGIAN SGSFNTGIGN TGNTNTGLFN SGDVNTGAFN PGSFNTGSFN TGSFNTGGFN      1260
     PGNTNTGYLN IGNYNTGIAN TGDVDTGAFI TGNYSNGLFL SGDYQGLVGL NLVIDMPLPI      1320
     SLGVNIPIDI PITASAGNIT LMGVTIPPTG DIVLSSIAGQ RAHFGPITIP NITVVGPTTT      1380
     VAIGGPNTAI TITGGGAIRI PLISIPAAPG FGNSTTNPSS GFFNTGAGGA SGFGNFGGAN      1440
     SGFWNLASAT SGASGLLNVG ALGSGLANVG TTVSGFYNTS TSDLATPAFN SGLANISTSI      1500
     AGLLRDSTGT MVLNLGLANH GTLNVGIANL GDYNIGFANL GSANFGSANI GGNNIGGANT      1560
     GIFDIGLANL GSYNIGFGNF GDDNLGFANT GSNNIGFANT GSNNIGIGLT GDGQIGFGSL      1620
     NSGSGNIGLF NSGSGNIGFF NSGNGNVGIG NTGTANFGLG NTGSTNTGFF NSGDVNTGIG      1680
     NTGSFNTGSF NPGDSNTGDF NPGSYNTGLG NTGDVDTGAF ISGSYSNGFL WSGNYQGLIG      1740
     LHAALAIPEI ALTFGVDIPI HIPINIDAGV VTLQGFSIVA AENNIDFTPI IIPTINITLP      1800
     TAAITVGGPT TSIGITASAG IGSITIPIID IPATSGFGNS TTSPSSGFFN SGAGSASGFL      1860
     NVVAGASGIS GYLNVGALGS GVTNVGHTVS GFYNASALDL VTPAFASGLM RDGMGTMTLN      1920
     LGLANLGSNN AGFGNTGIFD VGVANLGNYN IGFGNFGDDN LGFANLGSYN IGVANTGSNN      1980
     IGFANTGSNN IGIGLTGTGQ IGIGALNSGS GNIGLFNSGD GNIGFFNSGT GNFGIGNTGT      2040
     GNFGIGNSGS TSTGLFNSGD GNTGGFNPGN FNTGNFNTGS FNTGGFNAGN TNTGHFNTGN      2100
     YNTGIANTGD VSTGAFISGN YSNGILWRGD YQGLIGYSYA LTIPEIPAHL DVNIPIDIPI      2160
     TGSFTDLVVD NFTIPIIGFE SFAFSFHIHT EPDIGPIIVP SFVLSVPTFA IAVGGPTTAI      2220
     NISATAGLGP ITIPIIDIPA APGIGNSTTS PSSGFFNTGA GTASGFGNVG GNTSGLWNLA      2280
     SAASGVSGLL NVGALGSGVA NVGNTISGIY NTSPLDLGTP AFGSGLANIA GLLQGGAGTT      2340
     ILDLAGLGNL NVGLANLGGS NFGIGNTGIF NVGFANVGNH NIGLANLGNY SVGFANSGNY      2400
     HIGIANTGSA NIGFANTGSG NIGIGLTGTG QIGFGSFNSG SHNIGLFNSG DGNVGFFNSG      2460
     TGNVGIGNTG TANFGIANSG SFNTGLGNTG STNTGLFNPG NVNTGVGNTG SINTGSINTG      2520
     SFNTGSTNTG SFNLGDHNTG SFNSGDYNTG YFNAGDYNTG VANTGNVNTG AFISGNYSNG      2580
     FFWRGDYQGL IGLSTTITIP EIPYRYDLSV PIDIPITGTV VATTPNSFTI PGFQIRVLLG      2640
     PAAVLVNEMI GPITIDVNQV IAIDSPIQQT ISMVGTGGFG PIPIGISIGG TPGFGNSTTG      2700
     PSSGFFHTGA GHVSGFGNFG AGNMSGSGNF GAGNSGFFNA GGLGNSGLLN FGALQSGLAN      2760
     LGNTISGVYN TSTLDLATPA FGSGIANIGA NLAGLFLDNT GNLTLNFGVA NQGGLNAGIG      2820
     NLGSVNIGFV NTGDSNLGIG NLGDLNFGGV NIGGNNIGIA NTGIFDIGLA NLGSYNIGLA      2880
     NLGDDNLGFG NAGSYNIGFA NFGSDNLGFA NTGSYNIGFA NTGNNNIGVG LTGNGQIGIG      2940
     SLNSGSNNIG LFNSGSGNIG FFNSGTGNVG IFNTGTGNFG LANSGGFNTG IGNAGSTNTG      3000
     VFNPGDLNTG SFNPGSFNTG GFNPGSGNTG YLNTGDYNTG VANTGDVDTG AFITGSYSNG      3060
     FLVSGDYQGL IGLPLLGIPV TPGYFNLTGG PSSGFFNSGA GSVSGFVNSG AGLSGYLNTG      3120
     ALGSGVANVG NTISGWLNAS ALDLATPGFL SGIGNFGTNL AGFFRG                     3166
//

If you have problems or comments...

PBIL Back to PBIL home page