(data stored in ACNUC1104 zone)

EMBL: CP000717.PE317

CP000717.PE317       Location/Qualifiers
FT   CDS             383636..385498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10317"
FT                   /old_locus_tag="TBFG_00309"
FT                   /product="conserved proline and threonine rich protein"
FT                   /note="Mapped to H37Rv Rv0312"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10317"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04660"
FT                   /protein_id="ABR04660.1"
FT                   /translation="MYDPLGLSIGTTNLVAAGNGGPPVTRRAVLTLYPHCAPKIGVPSQ
FT                   NPNLIEPGALMSGFVERIGDAVALVSPDGSVHDPDLLLVEALDAMVLTAGADASSSEIA
FT                   IAVPAHWKPGAVHALRNGLRTHVGFVRSGMAPRLVSDAIAALTAVNSELGLPHGSVVGL
FT                   LDFGGSATYVTLVETKSDSRTSDFQPVSATARYQDFSGSQIDQALLLRVIDQFGYGDDV
FT                   DPASTAAVGQLGQLREQCRAAKERLSTDVATELFAELAGCSSSIEMTREQLEDLIQDPL
FT                   TGFIYAFDDMLARHNASWADLAAVVTVGGGANIPLVTQRLSFHTRRPVLTASQPGCAAA
FT                   MGALLLANRGGERDSRTRTSIGLATAAAAGTSVIELPAGDVMVIDHEALTDRELAWSQT
FT                   DFPSEAPARFEGDSYNEGGPCWSMRLNAVEPPKGPAWRRIRVSQLLIGVSAVVAMTAIG
FT                   GVALTLTAIERRPSPLPTPIVPGLAPMPPGSVVPSSRAPTPPPPPSTVAPLPSAAPAPT
FT                   TVAPAPPPPTQVVTTTTAPPVTTTPRPSPTTTTTTAPPSTTTTTEPPVTTTSTIPTIPT
FT                   TTTTVKMTTEWLHVPFLPVPIPVPIPQNPGAGEPQNPFGSLGSG"
     MYDPLGLSIG TTNLVAAGNG GPPVTRRAVL TLYPHCAPKI GVPSQNPNLI EPGALMSGFV        60
     ERIGDAVALV SPDGSVHDPD LLLVEALDAM VLTAGADASS SEIAIAVPAH WKPGAVHALR       120
     NGLRTHVGFV RSGMAPRLVS DAIAALTAVN SELGLPHGSV VGLLDFGGSA TYVTLVETKS       180
     DSRTSDFQPV SATARYQDFS GSQIDQALLL RVIDQFGYGD DVDPASTAAV GQLGQLREQC       240
     RAAKERLSTD VATELFAELA GCSSSIEMTR EQLEDLIQDP LTGFIYAFDD MLARHNASWA       300
     DLAAVVTVGG GANIPLVTQR LSFHTRRPVL TASQPGCAAA MGALLLANRG GERDSRTRTS       360
     IGLATAAAAG TSVIELPAGD VMVIDHEALT DRELAWSQTD FPSEAPARFE GDSYNEGGPC       420
     WSMRLNAVEP PKGPAWRRIR VSQLLIGVSA VVAMTAIGGV ALTLTAIERR PSPLPTPIVP       480
     GLAPMPPGSV VPSSRAPTPP PPPSTVAPLP SAAPAPTTVA PAPPPPTQVV TTTTAPPVTT       540
     TPRPSPTTTT TTAPPSTTTT TEPPVTTTST IPTIPTTTTT VKMTTEWLHV PFLPVPIPVP       600
     IPQNPGAGEP QNPFGSLGSG                                                   620
//

If you have problems or comments...

PBIL Back to PBIL home page