(data stored in ACNUC1104 zone)

EMBL: CP000717.PE319

CP000717.PE319       Location/Qualifiers
FT   CDS             complement(385959..386621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10319"
FT                   /old_locus_tag="TBFG_00311"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0314c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10319"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04662"
FT                   /protein_id="ABR04662.1"
FT                   /translation="MIVVWEHLCMNPEDDPEARIRELERPLADVARASELGGSQSGGYT
FT                   YPPGPPPPPYSYGGPFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSQG
FT                   NFVVLSPTPSVSRAVPTPTAQPATTLPPAGASLSVSGVNVNRTIACNDSIVSVSGMSNT
FT                   VVITGHCTSLTVSGMRNSVTVDSVDTIEAAGFNNEVTYHSGSPKISNAGGSNSVQQG"
     MIVVWEHLCM NPEDDPEARI RELERPLADV ARASELGGSQ SGGYTYPPGP PPPPYSYGGP        60
     FGGPSPRSSS GNRAWWILAA VVVVGVLVLV GGIAAFSAQR LSQGNFVVLS PTPSVSRAVP       120
     TPTAQPATTL PPAGASLSVS GVNVNRTIAC NDSIVSVSGM SNTVVITGHC TSLTVSGMRN       180
     SVTVDSVDTI EAAGFNNEVT YHSGSPKISN AGGSNSVQQG                             220
//

If you have problems or comments...

PBIL Back to PBIL home page