(data stored in ACNUC1104 zone)

EMBL: CP000717.PE33

CP000717.PE33        Location/Qualifiers
FT   CDS             36968..37363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10033"
FT                   /old_locus_tag="TBFG_00033"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0034"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10033"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04376"
FT                   /protein_id="ABR04376.1"
FT                   /translation="MTDDADLDLVRRTFAAFARGDLAELTQCFAPDVEQFVPGKHALAG
FT                   VFRGVDNVVACLGDTAAAADGTMTVTLEDVLSNTDGQVIAVYRLRASRAGKVLDQREAI
FT                   LVTVAGGRITRLSEFYADPAATESFWA"
     MTDDADLDLV RRTFAAFARG DLAELTQCFA PDVEQFVPGK HALAGVFRGV DNVVACLGDT        60
     AAAADGTMTV TLEDVLSNTD GQVIAVYRLR ASRAGKVLDQ REAILVTVAG GRITRLSEFY       120
     ADPAATESFW A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page