(data stored in ACNUC1104 zone)

EMBL: CP000717.PE333

CP000717.PE333       Location/Qualifiers
FT   CDS             397191..397793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10333"
FT                   /old_locus_tag="TBFG_00325"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR/acrR-family"
FT                   /note="Mapped to H37Rv Rv0328"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10333"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04676"
FT                   /protein_id="ABR04676.1"
FT                   /translation="MQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINY
FT                   HFGSKDALLDDALGRCFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIRPAVY
FT                   ACVESYAPALRSEALRERLAAGYADVRQHSVDLAGAALAGTDIAPPENLSTIVSVLMAV
FT                   IDGLMIQWIADPSATPRSTEVIRALASIGAVVTSQLR"
     MQQQRTNRDK LLDGALACLR ERGYGNTSSR DIARAAGVNI ASINYHFGSK DALLDDALGR        60
     CFSTWNQRVQ EAFDHSRAAG PAGQILAVLE ATVDSFEQIR PAVYACVESY APALRSEALR       120
     ERLAAGYADV RQHSVDLAGA ALAGTDIAPP ENLSTIVSVL MAVIDGLMIQ WIADPSATPR       180
     STEVIRALAS IGAVVTSQLR                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page