(data stored in ACNUC1104 zone)

EMBL: CP000717.PE347

CP000717.PE347       Location/Qualifiers
FT   CDS             413918..415840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10347"
FT                   /old_locus_tag="TBFG_00339"
FT                   /product="isoniazid inductible gene protein iniA"
FT                   /note="Mapped to H37Rv Rv0342"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10347"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04690"
FT                   /protein_id="ABR04690.1"
FT                   /translation="MVPAGLCAYRDLRRKRARKWGDTVTQPDDPRRVGVIVELIDHTIA
FT                   IAKLNERGDLVQRLTRARQRITDPQVRVVIAGLLKQGKSQLLNSLLNLPAARVGDDEAT
FT                   VVITVVSYSAQPSARLVLAAGPDGTTAAVDIPVDDISTDVRRAPHAGGREVLRVEVGAP
FT                   SPLLRGGLAFIDTPGVGGLGQPHLSATLGLLPEADAVLVVSDTSQEFTEPEMWFVRQAH
FT                   QICPVGAVVATKTDLYPRWREIVNANAAHLQRARVPMPIIAVSSLLRSHAVTLNDKELN
FT                   EESNFPAIVKFLSEQVLSRATERVRAGVLGEIRSATEQLAVSLGSELSVVNDPNLRDRL
FT                   ASDLERRKREAQQAVQQTALWQQVLGDGFNDLTADVDHDLRTRFRTVTEDAERQIDSCD
FT                   PTAHWAEIGNDVENAIATAVGDNFVWAYQRSEALADDVARSFADAGLDSVLSAELSPHV
FT                   MGTDFGRLKALGRMESKPLRRGHKMIIGMRGSYGGVVMIGMLSSVVGLGLFNPLSVGAG
FT                   LILGRMAYKEDKQNRLLRVRSEAKANVRRFVDDISFVVSKQSRDRLKMIQRLLRDHYRE
FT                   IAEEITRSLTESLQATIAAAQVAETERDNRIRELQRQLGILSQVNDNLAGLEPTLTPRA
FT                   SLGRA"
     MVPAGLCAYR DLRRKRARKW GDTVTQPDDP RRVGVIVELI DHTIAIAKLN ERGDLVQRLT        60
     RARQRITDPQ VRVVIAGLLK QGKSQLLNSL LNLPAARVGD DEATVVITVV SYSAQPSARL       120
     VLAAGPDGTT AAVDIPVDDI STDVRRAPHA GGREVLRVEV GAPSPLLRGG LAFIDTPGVG       180
     GLGQPHLSAT LGLLPEADAV LVVSDTSQEF TEPEMWFVRQ AHQICPVGAV VATKTDLYPR       240
     WREIVNANAA HLQRARVPMP IIAVSSLLRS HAVTLNDKEL NEESNFPAIV KFLSEQVLSR       300
     ATERVRAGVL GEIRSATEQL AVSLGSELSV VNDPNLRDRL ASDLERRKRE AQQAVQQTAL       360
     WQQVLGDGFN DLTADVDHDL RTRFRTVTED AERQIDSCDP TAHWAEIGND VENAIATAVG       420
     DNFVWAYQRS EALADDVARS FADAGLDSVL SAELSPHVMG TDFGRLKALG RMESKPLRRG       480
     HKMIIGMRGS YGGVVMIGML SSVVGLGLFN PLSVGAGLIL GRMAYKEDKQ NRLLRVRSEA       540
     KANVRRFVDD ISFVVSKQSR DRLKMIQRLL RDHYREIAEE ITRSLTESLQ ATIAAAQVAE       600
     TERDNRIREL QRQLGILSQV NDNLAGLEPT LTPRASLGRA                             640
//

If you have problems or comments...

PBIL Back to PBIL home page