(data stored in ACNUC1104 zone)

EMBL: CP000717.PE357

CP000717.PE357       Location/Qualifiers
FT   CDS             425532..426719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10357"
FT                   /old_locus_tag="TBFG_00349"
FT                   /product="chaperone protein dnaJ1"
FT                   /note="Mapped to H37Rv Rv0352"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10357"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04700"
FT                   /protein_id="ABR04700.1"
FT                   /translation="MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGN
FT                   PAAGERFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGD
FT                   GAEFNLNDLFDAASRTGGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAK
FT                   GVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGS
FT                   GSIIEHPCEECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTV
FT                   HVRPDKIFGRDGDDLTVTVPVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRG
FT                   RGVPKRSGGSGDLLVTVKVAVPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR"
     MAQREWVEKD FYQELGVSSD ASPEEIKRAY RKLARDLHPD ANPGNPAAGE RFKAVSEAHN        60
     VLSDPAKRKE YDETRRLFAG GGFGGRRFDS GFGGGFGGFG VGGDGAEFNL NDLFDAASRT       120
     GGTTIGDLFG GLFGRGGSAR PSRPRRGNDL ETETELDFVE AAKGVAMPLR LTSPAPCTNC       180
     HGSGARPGTS PKVCPTCNGS GVINRNQGAF GFSEPCTDCR GSGSIIEHPC EECKGTGVTT       240
     RTRTINVRIP PGVEDGQRIR LAGQGEAGLR GAPSGDLYVT VHVRPDKIFG RDGDDLTVTV       300
     PVSFTELALG STLSVPTLDG TVGVRVPKGT ADGRILRVRG RGVPKRSGGS GDLLVTVKVA       360
     VPPNLAGAAQ EALEAYAAAE RSSGFNPRAG WAGNR                                  395
//

If you have problems or comments...

PBIL Back to PBIL home page