(data stored in ACNUC1104 zone)

EMBL: CP000717.PE36

CP000717.PE36        Location/Qualifiers
FT   CDS             complement(39978..41303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10036"
FT                   /old_locus_tag="TBFG_00036"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0037c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10036"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04379"
FT                   /protein_id="ABR04379.1"
FT                   /translation="MPRVEVGLVIHSRMHARAPVDVWRSVRSLPDFWRLLQVRVASQFG
FT                   DGLFQAGLAGALLFNPDRAADPMAIAGAFAVLFLPYSLLGPFAGALMDRWDRRWVLVGA
FT                   NTGRLALIAGVGTILAVGAGDVPLLVGALVANGLARFVASGLSAALPHVVPREQVVTMN
FT                   SVAIASGAVSAFLGANFMLLPRWLLGSGDEGASAIVFLVAIPVSIALLWSLRFGPRVLG
FT                   PDDTERAIHGSAVYAVVTGWLHGARTVVQLPTVAAGLSGLAAHRMVVGINSLLILLLVR
FT                   HVTARAVGGLGTALLFFAATGLGAFLANVLTPTAIRRWGRYATANGALAAAATIQVAAA
FT                   GLLVPVMVVCGFLLGVAGQVVKLCADSAMQMDVDDALRGHVFAVQDALFWVSYILSITV
FT                   AAALIPEHGHAPVFVLFGSAIYLAGLVVHTIVGRRGQPVIGR"
     MPRVEVGLVI HSRMHARAPV DVWRSVRSLP DFWRLLQVRV ASQFGDGLFQ AGLAGALLFN        60
     PDRAADPMAI AGAFAVLFLP YSLLGPFAGA LMDRWDRRWV LVGANTGRLA LIAGVGTILA       120
     VGAGDVPLLV GALVANGLAR FVASGLSAAL PHVVPREQVV TMNSVAIASG AVSAFLGANF       180
     MLLPRWLLGS GDEGASAIVF LVAIPVSIAL LWSLRFGPRV LGPDDTERAI HGSAVYAVVT       240
     GWLHGARTVV QLPTVAAGLS GLAAHRMVVG INSLLILLLV RHVTARAVGG LGTALLFFAA       300
     TGLGAFLANV LTPTAIRRWG RYATANGALA AAATIQVAAA GLLVPVMVVC GFLLGVAGQV       360
     VKLCADSAMQ MDVDDALRGH VFAVQDALFW VSYILSITVA AALIPEHGHA PVFVLFGSAI       420
     YLAGLVVHTI VGRRGQPVIG R                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page