(data stored in ACNUC1104 zone)

EMBL: CP000717.PE363

CP000717.PE363       Location/Qualifiers
FT   CDS             440028..440675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10363"
FT                   /old_locus_tag="TBFG_00355"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0358"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10363"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04706"
FT                   /protein_id="ABR04706.1"
FT                   /translation="MYTAENAPGVAVLLSGDADVPGPLTGLPTHQDNLDTVIGRYSRLI
FT                   VVGADADLGAVLTRLLRTDRLDVEVGYVPRRRSPATRAYRLPAGRRAARRARCGVARRV
FT                   PLIRDETGSVIVGRAQWLPAEEQALIHGEAVVDDTVLFDGDVAGVCIEPTLTLPGLRAA
FT                   VDGAGKWRRWIGGRAAQLGTTGAAVLRDGVAAPRPVRRSTFYRNVEGWLLVR"
     MYTAENAPGV AVLLSGDADV PGPLTGLPTH QDNLDTVIGR YSRLIVVGAD ADLGAVLTRL        60
     LRTDRLDVEV GYVPRRRSPA TRAYRLPAGR RAARRARCGV ARRVPLIRDE TGSVIVGRAQ       120
     WLPAEEQALI HGEAVVDDTV LFDGDVAGVC IEPTLTLPGL RAAVDGAGKW RRWIGGRAAQ       180
     LGTTGAAVLR DGVAAPRPVR RSTFYRNVEG WLLVR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page