(data stored in ACNUC1104 zone)

EMBL: CP000717.PE364

CP000717.PE364       Location/Qualifiers
FT   CDS             440686..441465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10364"
FT                   /old_locus_tag="TBFG_00356"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0359"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10364"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04707"
FT                   /protein_id="ABR04707.1"
FT                   /translation="MSETGQRESVRPSPIFLGLLGLTAVGGALAWLAGETVQPLAYAGV
FT                   FVMVIAGWLVSLCLHEFGHAFTAWRFGDHDVAVRGYLTLDPRRYSHPMLSLGLPMLFIA
FT                   LGGIGLPGAAVYVHTWFMTTARRTLVSLAGPTVNLALAMLLLAATRLLFDPIHAVLWAG
FT                   VAFLAFLQLTALVLNLLPIPGLDGYAALEPHLRPETQRALAPAKQFALVFLLVLFLAPT
FT                   LNGWFFGVVYWLFDLSGVSHRLAAAGSVLARFWSIWF"
     MSETGQRESV RPSPIFLGLL GLTAVGGALA WLAGETVQPL AYAGVFVMVI AGWLVSLCLH        60
     EFGHAFTAWR FGDHDVAVRG YLTLDPRRYS HPMLSLGLPM LFIALGGIGL PGAAVYVHTW       120
     FMTTARRTLV SLAGPTVNLA LAMLLLAATR LLFDPIHAVL WAGVAFLAFL QLTALVLNLL       180
     PIPGLDGYAA LEPHLRPETQ RALAPAKQFA LVFLLVLFLA PTLNGWFFGV VYWLFDLSGV       240
     SHRLAAAGSV LARFWSIWF                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page