(data stored in ACNUC1104 zone)

EMBL: CP000717.PE365

CP000717.PE365       Location/Qualifiers
FT   CDS             complement(441470..441907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10365"
FT                   /old_locus_tag="TBFG_00357"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0360c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10365"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04708"
FT                   /protein_id="ABR04708.1"
FT                   /translation="MTKRTITPMTSMGDLLGPEPILLPGDSDAEAELLANESPSIVAAA
FT                   HPSASVAWAVLAEGALADDKTVTAYAYARTGYHRGLDQLRRHGWKGFGPVPYSHQPNRG
FT                   FLRCVAALARAAAAIGETDEYGRCLDLLDDCDPAARPALGL"
     MTKRTITPMT SMGDLLGPEP ILLPGDSDAE AELLANESPS IVAAAHPSAS VAWAVLAEGA        60
     LADDKTVTAY AYARTGYHRG LDQLRRHGWK GFGPVPYSHQ PNRGFLRCVA ALARAAAAIG       120
     ETDEYGRCLD LLDDCDPAAR PALGL                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page