(data stored in ACNUC1104 zone)

EMBL: CP000717.PE369

CP000717.PE369       Location/Qualifiers
FT   CDS             445563..446246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10369"
FT                   /old_locus_tag="TBFG_00361"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0364"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10369"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04712"
FT                   /protein_id="ABR04712.1"
FT                   /translation="MSTAVTAMPDILDPMYWLGANGVFGSAVLPGILIIVFIETGLLFP
FT                   LLPGESLLFTGGLLSASPAPPVTIGVLAPCVALVAVLGDQTAYFIGRRIGPALFKKEDS
FT                   RFFKKHYVTESHAFFEKYGKWTIILARFVPIARTFVPVIAGVSYMRYPVFLGFDIVGGV
FT                   AWGAGVTLAGYFLGSVPFVHMNFQLIILAIVFVSLLPALVSAARVYRARRNAPQSDPDP
FT                   LVLPE"
     MSTAVTAMPD ILDPMYWLGA NGVFGSAVLP GILIIVFIET GLLFPLLPGE SLLFTGGLLS        60
     ASPAPPVTIG VLAPCVALVA VLGDQTAYFI GRRIGPALFK KEDSRFFKKH YVTESHAFFE       120
     KYGKWTIILA RFVPIARTFV PVIAGVSYMR YPVFLGFDIV GGVAWGAGVT LAGYFLGSVP       180
     FVHMNFQLII LAIVFVSLLP ALVSAARVYR ARRNAPQSDP DPLVLPE                     227
//

If you have problems or comments...

PBIL Back to PBIL home page