(data stored in ACNUC1104 zone)

EMBL: CP000717.PE371

CP000717.PE371       Location/Qualifiers
FT   CDS             complement(447390..447983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10371"
FT                   /old_locus_tag="TBFG_00363"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0366c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10371"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04714"
FT                   /protein_id="ABR04714.1"
FT                   /translation="MKRLDLVAGPNGAGKSTFVALTLAPLLPGIVFVNADEIAKQRWPD
FT                   DPTSHAYQAAQVAADTRARLIDLGRPFIAETVFSHPSKLELIRTARTAGYTVVLHVLVI
FT                   PEGLAVERVRHRVAAGGHDVPETKIRERHRRLAELVAQAITLADGATVYDKSRLAGPRI
FT                   VAQFSGGGIIGRACWPSWTPPPLMSRWSNRPETA"
     MKRLDLVAGP NGAGKSTFVA LTLAPLLPGI VFVNADEIAK QRWPDDPTSH AYQAAQVAAD        60
     TRARLIDLGR PFIAETVFSH PSKLELIRTA RTAGYTVVLH VLVIPEGLAV ERVRHRVAAG       120
     GHDVPETKIR ERHRRLAELV AQAITLADGA TVYDKSRLAG PRIVAQFSGG GIIGRACWPS       180
     WTPPPLMSRW SNRPETA                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page