(data stored in ACNUC1104 zone)

EMBL: CP000717.PE372

CP000717.PE372       Location/Qualifiers
FT   CDS             complement(448012..448401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10372"
FT                   /old_locus_tag="TBFG_00364"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0367c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10372"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04715"
FT                   /protein_id="ABR04715.1"
FT                   /translation="MPKAVDRVTRVAADLVDSAAAEGARQSRSAKQQLDHWARVGRAVS
FT                   NQHTASRRRVEAALAGHLPMTDLTLEEGVVFNAEISAAIEERLSRTNYGDVLAAQGITT
FT                   VALNDAGDIVEHRPDGTSVVLAATP"
     MPKAVDRVTR VAADLVDSAA AEGARQSRSA KQQLDHWARV GRAVSNQHTA SRRRVEAALA        60
     GHLPMTDLTL EEGVVFNAEI SAAIEERLSR TNYGDVLAAQ GITTVALNDA GDIVEHRPDG       120
     TSVVLAATP                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page