(data stored in ACNUC1104 zone)

EMBL: CP000717.PE373

CP000717.PE373       Location/Qualifiers
FT   CDS             complement(448482..449693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10373"
FT                   /old_locus_tag="TBFG_00365"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0368c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10373"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04716"
FT                   /protein_id="ABR04716.1"
FT                   /translation="MATPALLPGVDLAAFAAALAARLRDAGIPVSASGQASLVQALQQL
FT                   VPRTPAALYWGARLTLVSRVDELATFDAVFASLFGVFGSAEPDGANRPPPPIAGPRTPV
FT                   AGVGHRAKRRSCAAQAQNLPWDTRSLTMASAGQGGPSRTLPDVLPSRIVARADEPFDQF
FT                   DPDDLRLLGAWLEATMARWPRRRSMRFESSPHGKRIDLRATMNASRSTGWESVLLARIR
FT                   PRRRPRRVLLLCDVSRSMQPYAAIYLRLMRAAVLRRAGGHPEVFAFSTSLTRLTSVLSH
FT                   RSAEMALHRANARVTDRYGGTFIGRSVAALLAPPHGNALRGAVVIIASDGWDSDPPDVL
FT                   VHALTRVRRRAELLVWLNPRAAHPEFQPRAGSMAAALPYCDLFLPAHSLAGLHQLLLAL
FT                   AGAR"
     MATPALLPGV DLAAFAAALA ARLRDAGIPV SASGQASLVQ ALQQLVPRTP AALYWGARLT        60
     LVSRVDELAT FDAVFASLFG VFGSAEPDGA NRPPPPIAGP RTPVAGVGHR AKRRSCAAQA       120
     QNLPWDTRSL TMASAGQGGP SRTLPDVLPS RIVARADEPF DQFDPDDLRL LGAWLEATMA       180
     RWPRRRSMRF ESSPHGKRID LRATMNASRS TGWESVLLAR IRPRRRPRRV LLLCDVSRSM       240
     QPYAAIYLRL MRAAVLRRAG GHPEVFAFST SLTRLTSVLS HRSAEMALHR ANARVTDRYG       300
     GTFIGRSVAA LLAPPHGNAL RGAVVIIASD GWDSDPPDVL VHALTRVRRR AELLVWLNPR       360
     AAHPEFQPRA GSMAAALPYC DLFLPAHSLA GLHQLLLALA GAR                         403
//

If you have problems or comments...

PBIL Back to PBIL home page