(data stored in ACNUC1104 zone)

EMBL: CP000717.PE377

CP000717.PE377       Location/Qualifiers
FT   CDS             complement(451798..452553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10377"
FT                   /old_locus_tag="TBFG_00369"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0372c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10377"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04720"
FT                   /protein_id="ABR04720.1"
FT                   /translation="MSISDRAAQLVAARTPFVRATVVRAQQPTSARPGDEAILLADGTI
FT                   EGFVGGHCAQNSVRKAAMGVLQAGESVLLRVLPDGDVHFPEAPGACVVVNPCLAGGSLE
FT                   IFLTPQLPAPLIQIYGETPIADALIELCGLLGYDARRDTDPADTDALPTAIVIASHGGP
FT                   EAEIIRTALDNGVGYVGLVASTVRGASILDSLDLSDAERARVHTPVGLAIGAKTPAEIA
FT                   VSIAAELIATLRGGGPRGRKALADENGGA"
     MSISDRAAQL VAARTPFVRA TVVRAQQPTS ARPGDEAILL ADGTIEGFVG GHCAQNSVRK        60
     AAMGVLQAGE SVLLRVLPDG DVHFPEAPGA CVVVNPCLAG GSLEIFLTPQ LPAPLIQIYG       120
     ETPIADALIE LCGLLGYDAR RDTDPADTDA LPTAIVIASH GGPEAEIIRT ALDNGVGYVG       180
     LVASTVRGAS ILDSLDLSDA ERARVHTPVG LAIGAKTPAE IAVSIAAELI ATLRGGGPRG       240
     RKALADENGG A                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page