(data stored in ACNUC1104 zone)

EMBL: CP000717.PE378

CP000717.PE378       Location/Qualifiers
FT   CDS             complement(452572..454971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10378"
FT                   /old_locus_tag="TBFG_00370"
FT                   /product="hypothetical carbon monoxyde dehydrogenase large
FT                   subunit"
FT                   /note="Mapped to H37Rv Rv0373c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10378"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04721"
FT                   /protein_id="ABR04721.1"
FT                   /translation="MTTIESRPPSPEDLADNAQQPCGHGRMMRKEDPRFIRGRGTYVDD
FT                   VALPGMLHLAILRSPYAHARIVRIDVTAAQAHPKVKAVVTGADLAAKGLAWMPTLANDV
FT                   QAVLATDKTRFQGQEVAFVVAEDRYSARDACELVDVDYEPRDPVVDARTALDPSAPVIR
FT                   TDLEGKSDNHIFDWETGDAAATEAVFAKADVVVQQEIVYPRVHPAPMETCGAVADLDPV
FT                   TGKLTLWTTSQAPHAHRTLYALVAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVAS
FT                   LLLDKPVKWMEDRSENLTSTGFARDYIMVGEIAANRDGKILAIRSNVLADHGAFNAQAA
FT                   PAKYPAGFFGVFTGSYDIEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCL
FT                   AFELKMDPAELRLRNLLRPNQFPYQSKTGWVYDSGDYETTMRKAMNMIGYEALRAEQKQ
FT                   RRARGELMGIGMSFFTEAVGAGPRKDMDILGLGMADGCELRVHPTGKAVLRLSVQTQGQ
FT                   GHETTFAQIVAEELGIAPDDIEVVHGDTDQTPFGLGTYGSRSTPVSGGAAALVARKVRD
FT                   KAKIIASGMLEVSVADLQWEKGKFHVKGDPSAAVTIADIAMRAHGAGDLPEGIEGGLDA
FT                   EVCYNPSNLTYPYGAYFCVVDIDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVD
FT                   GIGMALMEMIAFDEDGNCLGGSLMDYLIPTALEVPHLETGHTVTPSPHHPIGAKGIGES
FT                   ATVGSPPAVVNAVVDALAPFGVRHADMPLTPSRVWEAMQGRATPPI"
     MTTIESRPPS PEDLADNAQQ PCGHGRMMRK EDPRFIRGRG TYVDDVALPG MLHLAILRSP        60
     YAHARIVRID VTAAQAHPKV KAVVTGADLA AKGLAWMPTL ANDVQAVLAT DKTRFQGQEV       120
     AFVVAEDRYS ARDACELVDV DYEPRDPVVD ARTALDPSAP VIRTDLEGKS DNHIFDWETG       180
     DAAATEAVFA KADVVVQQEI VYPRVHPAPM ETCGAVADLD PVTGKLTLWT TSQAPHAHRT       240
     LYALVAGLPE HKIRVISPDI GGGFGNKVPI YPGYVCAIVA SLLLDKPVKW MEDRSENLTS       300
     TGFARDYIMV GEIAANRDGK ILAIRSNVLA DHGAFNAQAA PAKYPAGFFG VFTGSYDIEA       360
     AYCHMTAVYT NKAPGGVAYA CSFRITEAVY FVERLVDCLA FELKMDPAEL RLRNLLRPNQ       420
     FPYQSKTGWV YDSGDYETTM RKAMNMIGYE ALRAEQKQRR ARGELMGIGM SFFTEAVGAG       480
     PRKDMDILGL GMADGCELRV HPTGKAVLRL SVQTQGQGHE TTFAQIVAEE LGIAPDDIEV       540
     VHGDTDQTPF GLGTYGSRST PVSGGAAALV ARKVRDKAKI IASGMLEVSV ADLQWEKGKF       600
     HVKGDPSAAV TIADIAMRAH GAGDLPEGIE GGLDAEVCYN PSNLTYPYGA YFCVVDIDPG       660
     TAVVKVRRFL AVDDCGTRIN PMIIEGQVHG GIVDGIGMAL MEMIAFDEDG NCLGGSLMDY       720
     LIPTALEVPH LETGHTVTPS PHHPIGAKGI GESATVGSPP AVVNAVVDAL APFGVRHADM       780
     PLTPSRVWEA MQGRATPPI                                                    799
//

If you have problems or comments...

PBIL Back to PBIL home page