(data stored in ACNUC1104 zone)

EMBL: CP000717.PE380

CP000717.PE380       Location/Qualifiers
FT   CDS             complement(455462..456364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10380"
FT                   /old_locus_tag="TBFG_00372"
FT                   /product="hypothetical carbon monoxyde dehydrogenase medium
FT                   subunit"
FT                   /note="Mapped to H37Rv Rv0375c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10380"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04723"
FT                   /protein_id="ABR04723.1"
FT                   /translation="MQVPGPFEYERATSVDHAIGLLDRLGEGARVVAGGHSLLPMMKLR
FT                   IANPEYLVDINDLAPELGYVVVGGINNPNLVRLGAMTRHREILDSDALAAVCPIFRDAE
FT                   RVIADPVVRNRGTLGGSLCQADPAEDLSTVCTVLDAVCLAKGPSGEREIAIDDFLVGPY
FT                   ETALAHNEVLIEVRIPLRHNTSSAYAKVERRVGDWAITAAGAAVTLDGQTILAARVGLT
FT                   AVNPDPVALAELSAGLVGQPATEEVFAEAGRRAAQACTPVTDVRGTAEYKRHLAGELTV
FT                   RTLRTAAGRVLGAPAAPEA"
     MQVPGPFEYE RATSVDHAIG LLDRLGEGAR VVAGGHSLLP MMKLRIANPE YLVDINDLAP        60
     ELGYVVVGGI NNPNLVRLGA MTRHREILDS DALAAVCPIF RDAERVIADP VVRNRGTLGG       120
     SLCQADPAED LSTVCTVLDA VCLAKGPSGE REIAIDDFLV GPYETALAHN EVLIEVRIPL       180
     RHNTSSAYAK VERRVGDWAI TAAGAAVTLD GQTILAARVG LTAVNPDPVA LAELSAGLVG       240
     QPATEEVFAE AGRRAAQACT PVTDVRGTAE YKRHLAGELT VRTLRTAAGR VLGAPAAPEA       300
//

If you have problems or comments...

PBIL Back to PBIL home page