(data stored in ACNUC1104 zone)

EMBL: CP000717.PE381

CP000717.PE381       Location/Qualifiers
FT   CDS             complement(456398..457540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10381"
FT                   /old_locus_tag="TBFG_00373"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0376c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10381"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04724"
FT                   /protein_id="ABR04724.1"
FT                   /translation="MAIWAAGDTAGVATVVRTLRSAPRPPGAAMVVAPDGSVSGSVSGG
FT                   CVEGAVYELAAEVAQTGIPRLEHYGVSDDTAFAVGLTCGGIIDVFVEPVSRATFPELGE
FT                   LADDIGAQRPVAIATVIAHPDERRVGRRLVIRPDTKSPVTGSLGSARADAAVIDDARGL
FT                   LAVGRSEILEYGPDGQRRGEGMEVFVSSHAPRPRTLVFGAIDFAAALARQGSFLGYRVT
FT                   VCDARAVFATPARFPTADDVVVAWPHRYLAAQAEAGGIDERTVICVLTHDPKFDVPVLE
FT                   VALRLGVGYVGAMGSRKTHDDRMDRLRAAGLTDAELSRLSSPIGLDLGARTPEETAVSI
FT                   AADIIARRWGGGGRPLADIAGRIHHDAQVAGEFKDYLTRH"
     MAIWAAGDTA GVATVVRTLR SAPRPPGAAM VVAPDGSVSG SVSGGCVEGA VYELAAEVAQ        60
     TGIPRLEHYG VSDDTAFAVG LTCGGIIDVF VEPVSRATFP ELGELADDIG AQRPVAIATV       120
     IAHPDERRVG RRLVIRPDTK SPVTGSLGSA RADAAVIDDA RGLLAVGRSE ILEYGPDGQR       180
     RGEGMEVFVS SHAPRPRTLV FGAIDFAAAL ARQGSFLGYR VTVCDARAVF ATPARFPTAD       240
     DVVVAWPHRY LAAQAEAGGI DERTVICVLT HDPKFDVPVL EVALRLGVGY VGAMGSRKTH       300
     DDRMDRLRAA GLTDAELSRL SSPIGLDLGA RTPEETAVSI AADIIARRWG GGGRPLADIA       360
     GRIHHDAQVA GEFKDYLTRH                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page