(data stored in ACNUC1104 zone)

EMBL: CP000717.PE382

CP000717.PE382       Location/Qualifiers
FT   CDS             457589..458554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10382"
FT                   /old_locus_tag="TBFG_00374"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   lysR-family"
FT                   /note="Mapped to H37Rv Rv0377"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10382"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04725"
FT                   /protein_id="ABR04725.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAAELGLSDAGVSMHVAALRKELDD
FT                   PLFTRTGAGLAFTPGGLRLASRAVEILGLQQQTAIEVTEAAHGRRLLRIAASSAFAEHA
FT                   APGLIELFSSRADDLSVELSVHPTSRFRELICSRAVDIAIGPASESSIGSDGSIFLRPF
FT                   LKYQIITVVAPNSPLAAGIPMPALLRHQQWMLGPSAGSVDGEIATMLRGLAIPESQQRI
FT                   FQSDAAALEEVMRVGGATLAIGFAVAKDLAAGRLVHVTGPGLDRAGEWCVATLAPSARQ
FT                   PAVSELVGFISTPRCIQAMIPGSGVGVTRFRPKVHVTLWS"
     MTPAQLRAYS AVVRLGSVRA AAAELGLSDA GVSMHVAALR KELDDPLFTR TGAGLAFTPG        60
     GLRLASRAVE ILGLQQQTAI EVTEAAHGRR LLRIAASSAF AEHAAPGLIE LFSSRADDLS       120
     VELSVHPTSR FRELICSRAV DIAIGPASES SIGSDGSIFL RPFLKYQIIT VVAPNSPLAA       180
     GIPMPALLRH QQWMLGPSAG SVDGEIATML RGLAIPESQQ RIFQSDAAAL EEVMRVGGAT       240
     LAIGFAVAKD LAAGRLVHVT GPGLDRAGEW CVATLAPSAR QPAVSELVGF ISTPRCIQAM       300
     IPGSGVGVTR FRPKVHVTLW S                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page