(data stored in ACNUC1104 zone)

EMBL: CP000717.PE384

CP000717.PE384       Location/Qualifiers
FT   CDS             459145..459360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10384"
FT                   /old_locus_tag="TBFG_00376"
FT                   /product="protein transport protein secE2"
FT                   /note="Mapped to H37Rv Rv0379"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10384"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04727"
FT                   /protein_id="ABR04727.1"
FT                   /translation="MSVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDM
FT                   AVDSAGKITYRIKLEVSFKMRPAQPR"
     MSVYKVIDII GTSPTSWEQA AAEAVQRARD SVDDIRVARV IEQDMAVDSA GKITYRIKLE        60
     VSFKMRPAQP R                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page