(data stored in ACNUC1104 zone)

EMBL: CP000717.PE388

CP000717.PE388       Location/Qualifiers
FT   CDS             complement(461629..462483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10388"
FT                   /old_locus_tag="TBFG_00380"
FT                   /product="conserved secreted protein"
FT                   /note="Mapped to H37Rv Rv0383c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10388"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04731"
FT                   /protein_id="ABR04731.1"
FT                   /translation="MVPLWFTLSALCFVGAVVLLYVDIDRRRGRSRRRKSWARSHGFDY
FT                   ERESTEILKRWTRGVMSTVGDVAAHNVVLGQIRGEAVYIFDLEEVATVIALHRKVGTNV
FT                   VVDLRLKGLKEPRESDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMW
FT                   NEQNWTLVSMPIASTRAQWDEGLRTVRQFNDLLRVLPPLPQEMPQQTGVGPRGAAPGRP
FT                   VAPGGPAELPPRRAQPDPATTVLPDPARRAPEPIRRDEGRSEGVRRPPPAGRNGQQATN
FT                   YQH"
     MVPLWFTLSA LCFVGAVVLL YVDIDRRRGR SRRRKSWARS HGFDYEREST EILKRWTRGV        60
     MSTVGDVAAH NVVLGQIRGE AVYIFDLEEV ATVIALHRKV GTNVVVDLRL KGLKEPRESD       120
     IWLLGAIGPR MVYSTNLDAA RRACDRRMVT FAHTAPDCAE IMWNEQNWTL VSMPIASTRA       180
     QWDEGLRTVR QFNDLLRVLP PLPQEMPQQT GVGPRGAAPG RPVAPGGPAE LPPRRAQPDP       240
     ATTVLPDPAR RAPEPIRRDE GRSEGVRRPP PAGRNGQQAT NYQH                        284
//

If you have problems or comments...

PBIL Back to PBIL home page