(data stored in ACNUC1104 zone)

EMBL: CP000717.PE389

CP000717.PE389       Location/Qualifiers
FT   CDS             complement(462624..465170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10389"
FT                   /old_locus_tag="TBFG_00381"
FT                   /product="endopeptidase ATP binding protein subunit B clpB"
FT                   /note="Mapped to H37Rv Rv0384c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10389"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04732"
FT                   /protein_id="ABR04732.1"
FT                   /translation="MDSFNPTTKTQAALTAALQAASTAGNPEIRPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPQATGASTQPQLSRESLAAITTAQQLATELDDE
FT                   YVSTEHVMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPEPEATYQALQK
FT                   YSTDLTARAREGKLDPVIGRDNEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRDKTIVALDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGEGAMDAGNMIKPMLARGELRLVGATTLDEYRKHIEKDAALERRFQQVYVG
FT                   EPSVEDTIGILRGLKDRYEVHHGVRITDSALVAAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALSKEEDEASAERLAKLRSELADQKEKLAE
FT                   LTTRWQNEKNAIEIVRDLKEQLEALRGESERAERDGDLAKAAELRYGRIPEVEKKLDAA
FT                   LPQAQAREQVMLKEEVGPDDIADVVSAWTGIPAGRLLEGETAKLLRMEDELGKRVIGQK
FT                   AAVTAVSDAVRRSRAGVSDPNRPTGAFMFLGPTGVGKTELAKALADFLFDDERAMVRID
FT                   MSEYGEKHTVARLIGAPPGYVGYEAGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGHGRTVDFRNTILILTSNLGSGGSAEQVLAAVRATFKPEFINRLDDVLIF
FT                   EGLNPEELVRIVDIQLAQLGKRLAQRRLQLQVSLPAKRWLAQRGFDPVYGARPLRRLVQ
FT                   QAIGDQLAKMLLAGQVHDGDTVPVNVSPDADSLILG"
     MDSFNPTTKT QAALTAALQA ASTAGNPEIR PAHLLMALLT QNDGIAAPLL EAVGVEPATV        60
     RAETQRLLDR LPQATGASTQ PQLSRESLAA ITTAQQLATE LDDEYVSTEH VMVGLATGDS       120
     DVAKLLTGHG ASPQALREAF VKVRGSARVT SPEPEATYQA LQKYSTDLTA RAREGKLDPV       180
     IGRDNEIRRV VQVLSRRTKN NPVLIGEPGV GKTAIVEGLA QRIVAGDVPE SLRDKTIVAL       240
     DLGSMVAGSK YRGEFEERLK AVLDDIKNSA GQIITFIDEL HTIVGAGATG EGAMDAGNMI       300
     KPMLARGELR LVGATTLDEY RKHIEKDAAL ERRFQQVYVG EPSVEDTIGI LRGLKDRYEV       360
     HHGVRITDSA LVAAATLSDR YITARFLPDK AIDLVDEAAS RLRMEIDSRP VEIDEVERLV       420
     RRLEIEEMAL SKEEDEASAE RLAKLRSELA DQKEKLAELT TRWQNEKNAI EIVRDLKEQL       480
     EALRGESERA ERDGDLAKAA ELRYGRIPEV EKKLDAALPQ AQAREQVMLK EEVGPDDIAD       540
     VVSAWTGIPA GRLLEGETAK LLRMEDELGK RVIGQKAAVT AVSDAVRRSR AGVSDPNRPT       600
     GAFMFLGPTG VGKTELAKAL ADFLFDDERA MVRIDMSEYG EKHTVARLIG APPGYVGYEA       660
     GGQLTEAVRR RPYTVVLFDE IEKAHPDVFD VLLQVLDEGR LTDGHGRTVD FRNTILILTS       720
     NLGSGGSAEQ VLAAVRATFK PEFINRLDDV LIFEGLNPEE LVRIVDIQLA QLGKRLAQRR       780
     LQLQVSLPAK RWLAQRGFDP VYGARPLRRL VQQAIGDQLA KMLLAGQVHD GDTVPVNVSP       840
     DADSLILG                                                                848
//

If you have problems or comments...

PBIL Back to PBIL home page