(data stored in ACNUC1104 zone)

EMBL: CP000717.PE394

CP000717.PE394       Location/Qualifiers
FT   CDS             472761..473183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10394"
FT                   /old_locus_tag="TBFG_00386"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0390"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10394"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04737"
FT                   /protein_id="ABR04737.1"
FT                   /translation="MSYAGDITPLQAWEMLSDNPRAVLVDVRCEAEWRFVGVPDLSSLG
FT                   REVVYVEWATSDGTHNDNFLAELRDRIPADADQHERPVIFLCRSGNRSIGAAEVATEAG
FT                   ITPAYNVLDGFEGHLDAEGHRGATGWRAVGLPWRQG"
     MSYAGDITPL QAWEMLSDNP RAVLVDVRCE AEWRFVGVPD LSSLGREVVY VEWATSDGTH        60
     NDNFLAELRD RIPADADQHE RPVIFLCRSG NRSIGAAEVA TEAGITPAYN VLDGFEGHLD       120
     AEGHRGATGW RAVGLPWRQG                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page