(data stored in ACNUC1104 zone)

EMBL: CP000717.PE397

CP000717.PE397       Location/Qualifiers
FT   CDS             475951..477276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10397"
FT                   /old_locus_tag="TBFG_00389"
FT                   /product="13E12 repeat family protein"
FT                   /note="Mapped to H37Rv Rv0393"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10397"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04740"
FT                   /protein_id="ABR04740.1"
FT                   /translation="MAVGRCAIPRFDQAASGSAINGGQVHLSDGSTSPARQLPAPWPGD
FT                   AGAAAEGRAGVCCRGNRLPHVSDVGVSHRFDHRPAGVGAGGCRAGAAGAGLAVDDPGQL
FT                   AAAIDRIVAVADPDAVRQVRERARDREVSIWNSADGMGEVYAQLYATDAQALDARLNAL
FT                   VATVCAGDPRSTDQRRADALGALAAGADRLACRCDNPDCAAEGRPVSAVVIHVVAEQAS
FT                   VKGHGQAPAALLGGDGLIPAELVAELAKTAGLQPIPVPAGTEPGYRPSVKLAAFVRARD
FT                   LTCRAPGCDRPATQCDLDHTIAFADGGATHAANLKCLCRLHHLLATFCGWRAQQLPDGT
FT                   VIWTLPGNQTYVTTPGSALLFPALCTPTGDPPAPEPARADRRGQRTAMMPRRASTRTQN
FT                   RAHCIAAERHRNHQARRIAQAAVIATETHGPPPDPDDDPPPF"
     MAVGRCAIPR FDQAASGSAI NGGQVHLSDG STSPARQLPA PWPGDAGAAA EGRAGVCCRG        60
     NRLPHVSDVG VSHRFDHRPA GVGAGGCRAG AAGAGLAVDD PGQLAAAIDR IVAVADPDAV       120
     RQVRERARDR EVSIWNSADG MGEVYAQLYA TDAQALDARL NALVATVCAG DPRSTDQRRA       180
     DALGALAAGA DRLACRCDNP DCAAEGRPVS AVVIHVVAEQ ASVKGHGQAP AALLGGDGLI       240
     PAELVAELAK TAGLQPIPVP AGTEPGYRPS VKLAAFVRAR DLTCRAPGCD RPATQCDLDH       300
     TIAFADGGAT HAANLKCLCR LHHLLATFCG WRAQQLPDGT VIWTLPGNQT YVTTPGSALL       360
     FPALCTPTGD PPAPEPARAD RRGQRTAMMP RRASTRTQNR AHCIAAERHR NHQARRIAQA       420
     AVIATETHGP PPDPDDDPPP F                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page